ass fetish censored high vision incest sister




FC2NACRVENXIPXSHKDMIAACHRVSPRDHMNDTTATIDMIDEMEYDCAWDHNDONEZAMBIDASDVEMASTARSHUNTB

2022-01-07
122 min

[UMD-809]Pussy Grinding Hot Happening Good Times!! He Was Practicing Having Sex With His Little Stepsister When He Accidentally Slipped His Dick Inside Her!! 6

  • himari kinoshita himari hanazawa sarina momonaga censoredhandjobsisterUMDleodragon nishikawaUMD-809UMD809125umd00809
    • 2021-12-10
    216 min

    [HUNTB-158]"Is Step-sis Masturbating？" Step-sis Is On All Fours Masturbating With A Pen Between Her Legs, Training Her Lower Body And Ready For A Surprise...

  • censoredcreampiesisterHUNTBhunterkoichi davidsonhhh groupHUNTB-158HUNTB158huntb00158
    • 2021-10-08
    211 min

    [HUNTB-117]Cleaning -Shota Kitano-

  • censoredblowjobsisterHUNTBhunterkonnyaku kannohhh groupHUNTB-117HUNTB117huntb00117
    • 2021-09-05
    240 min

    [SIS-127]I Can No Longer Hold Out On How My Older Stepsister Looks Like From Behind!!! 4 Hours Of Creampies Doing It Doggy Style

  • censoredcreampiesisterSISglayzsisterSIS-127SIS12712sis00127
    • 2021-08-06
    121 min

    [UMD-790]Pussy Grinding Hot Happening Good Times!! He Was Practicing Having Sex With His Little Stepsister When He Accidentally Slipped His Dick Inside Her!! 4

  • nana maeno ichika matsumoto censoredhandjobsisterUMDleodoragon nishikawaUMD-790UMD790125umd00790
    • 2021-02-12
    146 min

    [JUFE-258]Big Booty Stepsister Can't Resist Her Hung Stepbrother - She's A Married Woman Now, But That Doesn't Mean This Innocent Slut Isn't Down To Cheat! Akari Neo

  • akari neo censoredcreampiesingle workJUFEfitchJUFE-258JUFE258jufe00258
    • 2020-12-31
    176 min

    [HUNTA-923]"She's Wearing A Thong？!" My Little Stepsister Normally Has Zero Erotic Appeal, But Her G-String's Got Me Rock Hard! I Couldn't Help Myself And Wound Up Pounding Her From Behind...

  • censoredcreampielingerieHUNTAhuntermorikihhh groupHUNTA-923HUNTA923hunta00923
    • 2020-12-05
    177 min

    [HUNTA-903]My Normally Completely Frigid And Bland Step-Sister Tries On Her New Club Uniform And Sticks Her Ass Out And Is Suddenly Super Hot! I Couldn't Help Myself And Ended Up Rawdogging Her And Giving Her Repeated Creampies And This Was The R

  • censoredcreampieschoolgirlHUNTAhuntercognac kaminohhh groupHUNTA-903HUNTA903hunta00903
    • 2020-08-30
    160 min

    [LULU-033]While Our Parents Were Away On Vacation For 3 Days, I Gave In To The Big Ass Temptation Of My Big Stepsister, Who Totally Totally Totally Loves Me, And Creampie Fucked Her Over And Over Again Aoi Mukai

  • ai mukai censoredcreampiesisterLULUlunaticsluminaxLULU-033LULU033lulu00033
    • 2020-08-29
    119 min

    [WANZ-976]Her Step-Parents See Her Face. Her Little Stepbrother Claims Her Ass! Her Step-Parents Can't See Her Horny Little Stepbrother Grinding Her Ass With His Cock And Cumming Over And Over Again With This Little Devil Big Stepsister Amy Fukad

  • emi fukada censoredslutsisterWANZwanz factorywanzWANZ-976WANZ976wanz00976
    • 2020-07-11
    35 min

    [HHKL-047]I Could See My Little Stepsister's Ass Bulging Out Of Her Knitted One Piece Dress And Her Knee-High Socks, And It Looked So Sexy That I Had To Fuck Her, And So I Creampie Fucked Her Over And Over Again, And As A Result...!？

  • censoredcreampiesisterHHKLhuntercognac kaminohhh groupHHKL-047HHKL047hhkl00047
    • 2020-07-10
    123 min

    [VRTM-513]We Gave Aphrodisiacs And S******g Pills To A Cabin Attendant With A Big Ass In Black Pantyhose! Then We Tied Her Up While She Was S******g And A*****ted Her With A Vibrator! Once She's Fully Aroused, She Gets Fucked Hard Until Her Knees

  • hasumi claire akari shinmura censoredbig titsVRTMv r produceeigo mochizukiVRTM-513VRTM513h-910vrtm00513
    • 2020-07-10
    114 min

    [VRTM-512]Sister Brainwashed And Turned Into Stepdad's Toys... 3

  • kanon kanon kiyoshi saki censoredcreampiesisterVRTMv r produceryo inugamiVRTM-512VRTM512h-910vrtm00512
    • 2020-06-06
    175 min

    [HUNTA-785]My Little Stepsister Was Wearing A Knitted One Piece Dress And Knee-High Socks, And Thrusting Out Her Ass, And I Could No Longer Resist, So I Plunged My Cock Into Her And After Creampie Fucking Her, Over And Over...!？ 2 Once She Became A C

  • censoredcreampiesisterHUNTAhuntercognac kaminohhh groupHUNTA-785HUNTA785hunta00785
    • 2020-02-14
    122 min

    [VRTM-481]Sister Brainwashed And Turned Into Stepdad's Toys... 2

  • yui nagase toua kotone censoredcreampiesisterVRTMv r produceolive yoshidaVRTM-481VRTM481h-910vrtm00481
    • 2019-12-13
    119 min

    [VRTM-471]This Kind And Gentle Big Ass Big Stepsister Was Wearing A Tight Skirt And Exerted Her Total Domain Over A Horny Little Stepbrother! When She Was Given Aphrodisiacs, She Started To Rub Her Knee-High Socks Against Him And Dripped Juicy Stains

  • nanako miyamura ririka censoredcreampiesisterVRTMv r producegoro koenjiVRTM-471VRTM471h-910vrtm00471
    • 2019-10-04
    160 min

    [DVDMS-454]A Normal Boys And Girls Documentary Adult Video This Big Ass Big Stepsister Is Hunting For A Job, And The Only Way She Can Relieve Her Stress Is To Have Creampie Sex With Her Little Stepbrother (But It's A Secret)

  • censoredcreampieamateurDVDMSdeep sjohan yuanDVDMS-454DVDMS454dvdms00454
    • 2019-09-13
    121 min

    [VRTM-453]This Little Brother-In-Law Is Lusting For His Kind And Gentle Big Ass Big Sister-In-Law Who Wears A Tight Skirt! When He Gave Her Aphrodisiacs To Drink She Started Rubbing Her Knee-High Socks Up Against Him And Staining Her Panties, And The

  • otsuki sound yuki sakuragi censoredcreampiesisterVRTMv r producerokutanzo no seishiVRTM-453VRTM453h-910vrtm00453
    • 2019-08-09
    131 min

    [VRTM-444]We Gave Aphrodisiacs And Sleeping Pills To A Cabin Attendant With A Big Ass In Black Pantyhose! Then We Tied Her Up While She Was Sleeping And Assaulted Her With A Vibrator! Once She's Fully Aroused, She Gets Fucked Hard Until Her Knees

  • otsuki sound yuki sakuragi censoreduniformsisterVRTMv r producegoro koenjiVRTM-444VRTM444h-910vrtm00444
    • 2019-08-03
    177 min

    [GDHH-162]Vertical Criss-Crossing Piston Cowgirl Sex For A Continuous 3 Consecutive Creampie Fuck!! My Big Sister-In-Law Has Recently Started That Beauty Ass Training That's All The Rage Nowadays, And She Was Wearing Tights And Thrusting Out Her

  • censoredcreampiesisterGDHHgolden timegorilla butahhh groupGDHH-162GDHH162gdhh00162
    • 2019-06-07
    215 min

    [DOCP-152]Sassy HS Sister's Jiggly Butt Temptation

  • nanaho kase aori arisei censoredschoolgirlsisterDOCPprestigedoc premiumDOCP-152DOCP152118docp00152
    • 2019-05-17
    141 min

    [VRTM-429]She's Only Wearing Hot Pants, But She's Not Wearing Panties! Seeing Flashes Of His Older Stepsisters Cunt, This Cherry Boy Little Stepbrother Is Suddenly Rock Hard! Unable To Hold Back, He Jumps His Stepsister For A Quickie! His Fir

  • akemi miu ayumi reika censoredcreampiesisterVRTMv r produceyamanaka socksVRTM-429VRTM429h-910vrtm00429
    • 2019-04-12
    149 min

    [VRTM-421]When This Freshly Graduated Kind And Gentle Big Sister With A Big Ass Came Into The Office Wearing Black Pantyhose, She Blew My Mind! Her Little Brother Couldn't Stop His Out Of Control Erection And Starting Rubbing His Cock Against Her

  • ayumi reika risa mochizuki censoredsisterVRTMv r produceeigo mochizukiVRTM-421VRTM421h-910vrtm00421
    • 2019-04-05
    160 min

    [DVDMS-383]I Gave In To My Big Stepsisters Big Ass Temptation And Fucked Her Raw And Creampie Ejaculated In Her Pussy Over And Over Again (This Is A True Story) While Our Parents Were Away On Vacation, My Big Sister, Who Loves Me Too Much, And I Were

  • censoredcreampieamateurDVDMSdeep sluminaxDVDMS-383DVDMS383dvdms00383
    • 2019-02-16
    238 min

    [HUNTA-558]Completely Bewitched By My Little Sister's Ass!! My Boner Pushes Up Against Her Pussy Over Her Panties! "I Didn't Know Your Ass Was This Cute!？" My Sister And I Have Been Close Since We Were Kids And All This Time I Didn�

  • censoredschoolgirlsisterHUNTAhuntermorikihhh groupHUNTA-558HUNTA558hunta00558
    • 2018-11-03
    215 min

    [HUNTA-515]Wake-Up Fucks Only! Little Sisters Who Like Getting Fucked From Behind! My Little Sister Always Has A Hard Time Waking Up In The Morning, And It's My Job To Get Her Up At First I Didn't Like Doing It, But One Day, I No Longer Minde

  • censoredsisterHUNTAhunterkoichi davidsonhhh groupHUNTA-515HUNTA515hunta00515
    • 2017-04-20
    208 min

    [SW-479]You Like My Ass, Don't You？ This Schoolgirl Little Sister Loves Her Big Brothers, So She's Always Prancing Around Wearing Nothing But Bloomers, Or White Panties, Or Mini Tights, Or Swimsuits, Or Thongs, So She Can Show Off Her Pretty

  • shiina sky censoredsistersingle workSWswitchlight fujimaswitch switchSW-479SW4791sw00479
    • 2016-11-07
    123 min

    [KTDS-918]Little Sister With Juicy Big Tits And A Shaved Pussy - Kurumi Kawane

  • kawaon walnut censoredbig titsbeautiful girlKTDSk tribeupdatingKTDS-918KTDS918h-094ktds00918
    • 2016-10-14
    174 min

    [VRTM-200]"I Want To Have My Big Brother's Baby!" When This Little Sister Suddenly Cums To Her Favorite Big Brother's Home, She Unexpectedly Finds His Fiancee There Too... Unwilling To Let His Little Sister Fuck Her Husband, She Gives

  • aya miyazaki kanna misaki censoredcreampiesisterVRTMv amp r producehosokawa kenVRTM-200VRTM200h-910vrtm00200
    • 2012-07-04
    120 min

    [YSN-334]Black haired teen brother and sister, near relative beautiful ass magazine Yukari Matsushita

  • matsushita hikari censoredsistersingle workYSNnonYSN-334YSN334h-127ysn00334
    • 2012-06-06
    120 min

    [YSN-330]Black haired teen brother and sister, near relative beautiful ass magazine Arisu Hayase

  • alice hayase censoredsisterbdsmYSNnonYSN-330YSN330h-127ysn00330



    • Jav Cherry, watch JAV streaming online japanese xxx