amateur jav censored delusion grou exclusive




FC2DASDSSISSDABKSBJHUNTBMARAAPODIPXAMBIEBODSSNIVEMASANAVSAWAAAGMEMHDKAMIDENNPJMVSD

2020-09-10
129 min

[MEKO-183]Married Woman Who Took A High Paying Part Time Job As A Nude Art Model Fucked And Filled With Cum 24

  • censoredcreampieamateurMEKOmature woman laboMEKO-183MEKO183h-1160meko00183
    • 2020-09-11
    301 min

    [THTH-023]ナンパで落とした上玉娘はナマOKのビッチちゃんだった！！

  • censoredcreampieamateurTHTHthree thousandTHTH-023THTH023h-1488thth00023
    • 2020-09-11
    150 min

    [ZMEN-065]This Female Teacher's Desperate For A Dicking - Her S*****ts Put A Vibrator In Her Pantyhose And She Just Can't Cum

  • natsuki kisaragi miyoshi nagi censoredbig titsZMENz mengoro koenjiZMEN-065ZMEN065h-1371zmen00065
    • 2020-09-12
    148 min

    [MEYD-622]A Half-Japanese Married Woman Airport Staffer Who Works For A Foreign Low-Cost Airline Was Upset When She Found Out That Her Husband Frequented Sex Clubs, So She Got Her Revenge By Making Her Adult Video Debut Mia Hanesaki

  • mia hasaki censoredbig titssingle workMEYDtameike goromichiru arashiyamaMEYD-622MEYD622meyd00622
    • 2020-09-12
    158 min

    [IPX-542]"If You've Missed Your Last Train Home, Why Don't You Cum Over To My Place？" My Lover Is Waiting At Home For Me, But After Missing The Last Train Home, I Ended Up Spending The Night At My Beautiful Lady Boss' Place... She

  • airi kijima eri kuriyama censoredcreampieblowjobIPXidea pocketkahori maedanodishIPX-542IPX542ipx00542
    • 2020-09-29

    FC2PPV 1518126 [Appearance] Prefectural volleyball club 172 cm ③ Saddle shot from loss of virginity during summer vacation 〇

  • amateur uncensoredfc2
    • 2020-10-16
    256 min

    [DNW-099]No More Daddy Issues! [Tricking An Insolent Daughter To Eat Her Pussy] 02

  • censoredcreampiebig titsDNWprestigedocument nowDNW-099DNW099118dnw00099
    • 2020-10-30
    115 min

    [PARATHD-3011]The Wife Of The Manager Of The Convenience Store Where I Work Is A Beautiful Mature Woman That No Man Can Resist. Highlights (2)

  • censoredmarried womanamateurPARATHDparadise tvPARATHD-3011PARATHD3011parathd03011
    • 2020-11-13
    116 min

    [KYMI-009]High Class Sluts With Colossal Tits Who Play Fully Clothed With Men In A High Leg Suite Room Mako Oda

  • oda mako censoredbig titsslutKYMImillyumeno aidaKYMI-009KYMI009kymi00009
    • 2020-11-26
    119 min

    [GS-364]This Rejuvenating Massage Parlor That Provides Deep And Rich Nipple-Licking Service Is Super Popular In Ikebukuro Right Now.

  • censoredGSsosoru x garconspada ikebukuroGS-364GS3641gs00364
    • 2020-12-21
    100 min

    [HAHOB-024]We Found A Members Only Lounge By The Harbor Where The Girls Do Non-Nude Erotica! Sari Nagahama

  • censoredbig titsbeautiful girlHAHOBhapiness holicHAHOB-024HAHOB024h-706hahob00024
    • 2021-01-07
    23 min

    FC2PPV 1635547 1800pt → 900pt [Gonzo] Call a married woman who is in an affair to her home and make a thick stranger stick and vaginal cum shot 3P

  • amateur uncensoredfc2
    • 2021-01-22
    121 min

    [DFE-051]My Awful Boss Is One Of Those Guys Who Can Fuck Forever Without Blowing His Load... Maron Natsuki

  • marin natsuki censoredcreampiesingle workDFEwaap entertainmentham the mcfearlessDFE-051DFE0512dfe00051
    • 2021-01-22
    34 min

    FC2PPV 1655375 [Sale for a limited time] Creampie in this wonderful world! Active 19-year-old JD layer Megu ○ n vaginal back mass cum shot 2 shots!

  • amateur uncensoredfc2
    • 2021-01-23
    18 min

    FC2PPV 1656362 Until the 26th 2480pt → 1980pt [Personal shooting] Natural daughter of Tokyo Metropolitan Commercial High School, four hungry meat sticks commit a shaved pussy in the car.

  • amateur uncensoredfc2
    • 2021-02-01
    302 min

    [DMOW-215]Dirty Talk Teacher And Male Subs - Complete BEST Collection 5 Hours Ichika Kamihata Asahi Mizuno Yuri Nikaido

  • ichika kamihata mizuno chaoyang censoredslutDMOWoffice k smowDMOW-215DMOW21536dmow00215
    • 2021-02-05
    239 min

    [SOUD-025]Sensitivity Turned Up To Max! Hedonic Sex With Flat Girl With Tiny Tits Special!!

  • censoredamateurbeautiful girlSOUDprestigebest fuckingSOUD-025SOUD025118soud00025
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-03-07
    310 min

    [YMSR-034]Anal NTR BEST 300 Min

  • censoredYMSRyama to sorasuperb.combosYMSR-034YMSR034ymsr00034
    • 2021-03-11
    129 min

    [FGAN-035]A Creampie Babe In Bloomers Nenne Nenne Ui

  • first love censoredcreampiesingle workFGANfetish eyesFGAN-035FGAN035h-1440fgan00035
    • 2021-03-13
    119 min

    [MIAA-408]During The Wedding, While Her Family Was There Beside Her, This Cunt Crack Loving Shotacon Sneaked Underneath Her Skirt And Started Playing With Her Pussy Until The Bride Ended Up Spasming And Pissing Herself While Cumming Nozomi Azuma

  • nozomi higashi censoredsquirtingsingle workMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-408MIAA408miaa00408
    • 2021-03-30
    42 min

    [MNSE-014](Online Only) College Call Girl - Creampie Sex OK! Miyabi - The Call Girl Who Came To Your Hotel Was Your C***dhood Friend! A Titty Fuck From Beautiful Tits, This G-Cup Is Ready To Get Fucked! - Miyabi Yurikawa

  • yurikawa masa censoredcreampiebig titsMNSEcrystal picturemaniac plusMNSE-014MNSE014mnse00014
    • 2021-04-02
    121 min

    [SSIS-026]5 Shameful Days Being Fucked By My Father-in-Law It Started The Monday My Husband Left For A Business Trip Saki Okuda

  • saki okuda censoredsquirtingsingle workSSISs1 no 1 stylerokusaburo mishimaSSIS-026SSIS026ssis00026
    • 2021-04-15
    240 min

    [AQMB-024]Another Man's Wife Falling Into Adulterous Creampies

  • censoredcreampiemarried womanAQMBaquamall emanuelaqua mallAQMB-024AQMB024aqmb00024
    • 2021-04-22
    63 min

    FC2PPV 1781541 [!! 2000pt for a limited time !!] Mao Beast, vaginal cum shot to a coveted beast ♥ "Senior, pour more … ♥" [Personal shooting]

  • amateur uncensoredfc2
    • 2021-06-05
    53 min

    H4610 tk0036 Kazuki Kikugawa 22years old

  • amateur uncensoredh4610
    • 2021-07-08
    248 min

    [MIST-341]Mr. Michiru - Exclusive Actress Audition Grand Prix Winner: Ayaka Mochizuki x Mr. Michiru - 4 Hours

  • ayaka mochizuki censoredcreampiebig titsMISTmr michirusaitaMIST-341MIST3411mist00341
    • 2021-07-09
    70 min

    OREX-269 Ayumi

  • amateur censoredcreampieamateurorexorex-269orex269orex-269
    • 2021-07-17
    118 min

    [CAWD-255]First Experiences At Age 18... Hard Dick Drilling! Her Pussy Awakens Her Inner Slut, And She Has Her First Ever Squirting Orgasm! First Creampie Special So Aoi

  • aoi sou censoredcreampiesquirtingCAWDkawaiitake dCAWD-255CAWD255cawd00255
    • 2021-07-24
    82 min

    200GANA-2526 Seriously Nampa, First Shot. 1666 [Look At Your Back Red! ] This Young Wife, Who Wore A Neat Atmosphere, Was Actually A Ridiculous Nympho Who Ate A Man Who Came To Dm By Putting An Erotic Photo On The Back Red! Squirting Barrage! Cum Man

  • amateur censoredmarried womansquirtingganagana-2526gana2526200gana-2526
    • 2021-07-30
    200 min

    [DVDMS-698]Eyes On Ordinary Guys And Girls - Collaboration Variety Show With The One-Way Mirror Cab - We"ve Heard That Athletic Girls Attending Sports Colleges Are Unusually Horny, But Is It True？ Can Competitive Cyclists Crush Your Cock With The

  • censoredamateurDVDMSdeepsnagase swingDVDMS-698DVDMS698dvdms00698
    • 2021-08-06
    54 min

    328HMDN-389 [Individual / Abs] An Elite Female Doctor, 45 Years Old, Is Completely Obedient To A Low-Educated Cock. Outflow Video That Is Blamed As Much As You Like For The Body Trained By Young People And Convulsions

  • amateur censoredcreampiemarried womanhmdnhmdn-389hmdn389328hmdn-389
    • 2021-08-14
    82 min

    522DHT-0276 [Exactly High Spec! A Talented Celebrity Wife Is Immersed In Pleasure! ] Unprotected, The Hole In The Butt Is Also Chi ● Ko And Oma ● The Joint Part Of Ko Is Also Exposed And Iku Many Times! "I Can’T Show It To My Husband In Such

  • amateur censoredcreampiemarried womandhtdht-0276dht0276522dht-0276
    • 2021-08-30
    75 min

    328HMDN-402 [Individual Shooting, G Cup 171 Cm] Personal Shooting Of A Beautiful Nurse 39 Years Old Being Humiliated By Her Husband’s Best Friend And Being Vaginal Cum Shot

  • amateur censoredcreampiebig titshmdnhmdn-402hmdn402328hmdn-402
    • 2021-09-06
    74 min

    FC2PPV 2163912 [First Thing] Legal Loli, High School Graduate Who Looks Younger Than Age 1st Year [3p, Free Nymph] Cum Inside Cusco! She Was A Bright Girl With A Good Personality Who Responded With A Smile.

  • amateur uncensoredfc2
    • 2021-09-24
    162 min

    [JUL-724]I Am Exposing My Beautiful Bride. Minori Hatsune

  • hatsune minori censoredcreampiebig titsJULmadonnaunicorn fukudaJUL-724JUL724jul00724
    • 2021-10-01
    245 min

    [ZMAR-050]All Out! Hana Haruna 2

  • haruna hana censoredcreampiebig titsZMARplanet plusmaruttoZMAR-050ZMAR050h-237zmar00050
    • 2021-10-02
    53 min

    H0930 ki211002 Requested work

  • amateur uncensoredh0930
    • 2021-10-09
    129 min

    [DNJR-060]Urethral Violation School

  • ichika matsumoto rina takase censoredsluthandjobDNJRinu mousozokunikukuso tei haramiDNJR-060DNJR060dnjr00060
    • 2021-10-10
    57 min

    HEYZO 2635 Sex With A Cosplayed MILF! – Sari Nakajima

  • sari nakajima uncensoredcreampieheyzo
    • 2021-10-14
    205 min

    [ABW-155]120肯定カノジョ VOL.02 絶倫で早漏な僕と、優しすぎるあいりのえちえち同棲性活 鈴村あいり

  • amateur censoredamateurabwabw-155abw155abw-155
    • 2021-10-22
    124 min

    [FOCS-030]The Industry"s No. 1 Make-Up Beauty Missed Her Last Train Home, So We Tried To Pick Her Up And You Won"t Believe What Happened - Smoking Hot Sex From Dusk Till Dawn! Dual Talents: Porn Star And Skilled Make-Up Artist？! Kaede Hiiragi

  • hiiragi kaede censoredblowjobsingle workFOCSabc mousou zokufocusFOCS-030FOCS030focs00030
    • 2021-10-30
    42 min

    481SACZ-084 Lina 1

  • amateur censoredbig titsamateursaczsacz-084sacz084481sacz-084
    • 2021-11-05
    230 min

    [HUNTB-133]"It"s Amazing When I Get Naked Like This!" 2 - She"s Barely Legal And Younger Than Me, But This School Friend Has An Amazing Sexy Style That Gives Me A Full Hard-on In No time.

  • censoredcreampieblowjobHUNTBhuntervolvo nakanohhh groupHUNTB-133HUNTB133huntb00133
    • 2021-11-08
    63 min

    [ETQR-307][Daydream POV] I am a Newlywed Guy who Had a Few Sips. I Unexpectedly Spent a Night Sharing a Room at a Hotel with a Junior Colleague from the Office. Marina Saito

  • marina saito censoredcreampieETQRerotic timeETQR-307ETQR307etqr00307
    • 2021-11-26
    44 min

    FC2PPV 2467232 [Translated Ant Special Price] [Appearance Available] [Caution For Deletion] The Translated Ant Has Been Stored, But Will Be Released. Nameless ○ Li Girl’S Creampie Sex

  • amateur uncensoredfc2
    • 2021-12-03
    150 min

    [WAAA-126]This Beautiful Girl Was Held In Confinement In This Decrepit Home By A Horny, Dirty Old Man And Impregnated With Semen Bukkake And Soiled To Her Soul While She Came With Pleasure ... Meisa Kawakita

  • kawakita meisa censoredcreampiebig titsWAAAones factorywanzWAAA-126WAAA126waaa00126
    • 2021-12-11
    239 min

    [CADV-834]The Girl Of My Dreams, Nanami Matsumoto

  • nana matsumoto censoredcreampiesingle workCADVcrystal eizoucrystal exCADV-834CADV834cadv00834
    • 2021-12-11
    131 min

    [APAK-208](Lewd Masochist! Twitching With Pleasure!) Model Tier Gorgeous Office Worker Works On Day Off To End Up Getting Pounded And Face-fucked Like Crazy For Intense Creampie Sex Caught On Camera. Riona Hirose

  • rio hirose censoredcreampiesingle workAPAKaurora project annexrkAPAK-208APAK208apak00208
    • 2021-12-17
    124 min

    [MVSD-490]Let"s Go To HEAVEN! Peniban Girls Dig Me Up And I Faint In Agony! Anal Cancelling All Night! Ichika Matsumoto Mei Satsuki

  • ichika matsumoto satsuki mei censoredcreampiebeautiful girlMVSDm s video groupsamoariMVSD-490MVSD490mvsd00490
    • 2022-01-02
    53 min

    188HINT-0502 Keiko 2

  • amateur censoredamateurmature womanhinthint-0502hint0502188hint-0502
    • 2022-01-13
    156 min

    [FANH-056]Pure Perverted Beautiful Girl, Karen, Is A Masochistic Girl Who Goes Crazy After Being Dilated With Adult Dick.

  • censoredcreampiesquirtingFANHhamedori.network secondeditionFANH-056FANH056h-1472fanh00056
    • 2022-01-21
    183 min

    [HUNTB-194]I Need My Dick For The Move-in Inspection At A Cheap Sharehouse？ When I Take The Tour The Inspectors Are Slutty Girls That Take Advantage To Fuck Me Non-stop, I Passed The Inspection...

  • censoredblowjobhandjobHUNTBhunterkoichi davidsonhhh groupHUNTB-194HUNTB194huntb00194
    • 2022-01-22
    132 min

    [CEMD-119]Step-Mother And Step-Son Anal Lesbian Ayaka Mochizuki Kayo Iwasawa - Lewd Perverted Step-Daughter Who Blames Her Mother-in-law"s Anus As One Woman!

  • ayaka mochizuki kayo iwasawa censoredanalbig titsCEMDceleb no tomoCEMD-119CEMD119cemd00119
    • 2022-01-22
    240 min

    [UMSO-433]Gorgeous House Cleaner Puts Aside Her Work And Seduces The Man Of The House By Masturbating In Front Of Him 15 Women

  • otsuki sound shiina sky censoredcreampieUMSOk m produceumanamiUMSO-433UMSO433umso00433
    • 2022-01-28
    62 min

    FC2PPV 2629624 * Diffusion Is Strictly Prohibited * Semi-Underground Idol 1？ Private Personal Photo Session With Saita Ota Sex Leaked Video [Deleted Project] [cen]

  • amateur uncensoredfc2



    • Jav Cherry, watch JAV streaming online japanese xxx