• Log in

  • Sign up
JavCherry
  • Home
  • Jav Uncensored
  • Jav Censored
  • New Releases
  • Trending
  • actors
  • Tags
  • Random Videos
  • Upload your videos
    • Log in
    • Sign up
  • Home
  • Jav Uncensored
  • Jav Censored
  • New Releases
  • Trending
  • Random
  • amateur

  • anal

  • bdsm

  • big tits

  • blowjob

  • bukkake

  • cosplay

  • creampie

  • cumshot

  • deepthroat

  • handjob

  • hardcore

  • japan

  • lesbian

  • lingerie

  • maid

  • married woman

  • massage

  • milf

  • nurse

  • office

  • outdoor

  • school

  • schoolgirl

  • single work

  • squirt

  • teacher

  • teen

  • uniform

1sw00756




FC2DASDDTTSPRDCESDLULUVENXBLKSTARSAMBIAPODAUKGATIDVEMAHNDMIDVSHKDFSDSSDASDPPPDONEZ

2021-02-11
135 min

[SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
  • 1



  • Jav Cherry, watch JAV streaming online japanese xxx
    • Legal

    • 18 U.S.C. 2257
    • Contact Us
    • DMCA
    • Useful

    • Sign up
    • Log in
    • FAQ
    • Contact
    • Friends

    • Girls Do Porn
    • GirlsDoPorn
    • DaftSex
    • TayLee Wood
    • WoodmanCastingX
    •