yuka oshima




FC2ONEZIPXPPPDSPRDSQTEMIDVSANSSNIMVSDFSDSSWAAAHMNCAWDJULGMEMCHRVCESDAVSAGVHEBOD

2020-11-19
180 min

[HUNBL-022]寝ている妹に強●イラマ漬け 妹がイラマチオの虜になるまで、喉奥を犯し続けた7日姦。

  • censoredschoolgirlsisterHUNBLhuntergeminihhh groupHUNBL-022HUNBL022hunbl00022
    • 2020-11-20
    93 min

    [KYUN-001](For Streaming Editions) # Heart Pounding Thrills 001/Hina/22 Years Old/College S*****t

  • censoredcreampieamateurKYUNprestigekyunKYUN-001KYUN001118kyun00001
    • 2020-11-23
    44 min

    FC2PPV 1581047 Twin-tailed shy girl ♥ I was kindly blaming for a shy girl, but at the end I got a vaginal cum shot from a stubborn piston … (laughs) * High quality version & review benefits included ♪

  • amateur uncensoredfc2
    • 2020-11-27
    179 min

    [MDVHJ-025]"I Can't Tell My Husband" Ravished By Her Own Husband's Employee...

  • harumi sagawa rieko hiraoka censoredcreampiemarried womanMDVHJgraffiti japanmovieMDVHJ-025MDVHJ02548mdvhj00025
    • 2020-11-27
    63 min

    417SRCN-052 [Love hotel reception girl] Black-haired Lori cute child is ashamed but hard to support virgin ED Ji ● Po! Completely erected Ji ● Po reward SEX! [Onasapo]

  • amateur censoredcreampieamateursrcnsrcn-052srcn052417srcn-052
    • 2020-11-27
    109 min

    [GONE-023]Tied Up, Crying And Screaming Rough Sex - Beautiful Girl Breaks

  • censoredcreampiebig titsGONEmercurya fair skinned elder sisterGONE-023GONE023h-1133gone00023
    • 2020-11-27
    120 min

    [DIC-079](Still In The Game) Beautiful Big Tits!! A Japanese Taiko Drummer Yu Matsuda Her Adult Video Debut A Super Genius And Super Aggressive Maso Bitch

  • masaru matsuda censoredbig titssingle workDICprestigejurassic yokoyamadiscoverDIC-079DIC079118dic00079
    • 2020-12-09
    64 min

    SIRO-4353 [First shot] [Momojiri x young skin] [Stimulation in the back of the vagina ..] Momojiri female college student with outstanding male reception participates in the war. The high-pitched glossy voice that shakes the delicate body and echoes

  • amateur censoredamateursirosiro-4353siro4353siro-4353
    • 2020-12-13
    127 min

    [APAK-188]Naughty Impregnation Field Trip - Dirty Teacher Breeds His Own Adorable S*****t Erina Oka

  • hill erina censoredcreampieschoolgirlAPAKaurora project annexrkaurora project anexAPAK-188APAK188apak00188
    • 2020-12-18
    32 min

    [BTH-102]Actual Secretary, Natural Slut. Aki Natsume ra

  • akira natsume censoredblowjobBTHchobitchchovicBTH-102BTH102h-1435bth00102
    • 2020-12-26
    43 min

    H4610 gol204 Misaki Kijima 20years old

  • amateur uncensoredh4610
    • 2020-12-31
    162 min

    [RBK-001]A Shame-Colored Stage My Days Of Breaking In Training Elly Akira

  • aki erie arai erie yuka osawa censoredanalbdsmRBKattackersusubashi suiryuu bakuRBK-001RBK001rbk00001
    • 2021-01-01
    178 min

    [DKSB-100]Rubbing Lesbian Pussies: Best Highlights

  • megumi shino ayumi takanashi censoredlesbianbeautiful girlDKSBoffice k sk s bestDKSB-100DKSB10036dksb00100
    • 2021-01-01
    120 min

    [EMOT-013]Enjoy A Newly Wed Lifestyle With Miho And Yui In This Complete POV Video

  • miho yui censoredcreampiebig titsEMOTplanet plusdirector oemotionEMOT-013EMOT013h-237emot00013
    • 2021-01-03
    12 min

    10musume 010321_01 Secret Pussy Collection: Shoko Takeda

  • amateur uncensored10musume
    • 2021-01-10
    52 min

    FC2PPV 1639182 [1200pt until 1/31] I made a popular 18-year-old refre girl cosplay and got fucked before Gachi lover ── Ikebukuro dispatch refre Aya-chan was dressed in uniform and vaginal cum shot, then scooped sperm and reinserted

  • amateur uncensoredfc2
    • 2021-01-13
    66 min

    FC2PPV 1643493 042 [Cum & Facial Cumshot] Let a daughter with a sickness drink a large amount of the juice and finally get completely dirty with 10 doppyu facial cumshots

  • amateur uncensoredfc2
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-17
    110 min

    [NYKD-110]First Time Shots At 60 Something - Tsubasa Fukayuki

  • miyuki tsubasa censoredmature womansingle workNYKDrubymaterukazu umiyamayokihiNYKD-110NYKD110nykd00110
    • 2021-01-21
    239 min

    [CADV-799]Fuck An Amateur Girl You Met In The Street Today! 7 Girls, 4 Hours

  • ichika matsumoto natsuki kisaragi censoredcreampiebig titsCADVcrystal eizocrystal exCADV-799CADV79949cadv00799
    • 2021-01-23
    50 min

    450OSST-008 A mysterious girlfriend who reads in the rain found in Korea, has a visual that is as good as an idol and a transcendental constriction! Defeat Saddle with shame play while sniffing the panties that you took off!

  • amateur censoredamateurosstosst-008osst008450osst-008
    • 2021-01-26
    124 min

    [SCPX-416]The Beautiful Girl Next Door Had A Fight With Her Boyfriend And Stormed Out Of The House In Her Underclothes. "It's Cold, Why Don't You Come In？" I Told Her, And Invited Her Into My Room, But When I Saw Her So Defenseless, W

  • censoredcreampiebig titsSCPXk m producehasshiscoop kmpSCPX-416SCPX416h-565scpx00416
    • 2021-01-27
    90 min

    435MFC-075 [Gonzo to try] Two vaginal cum shots to a pure innocent young lady JD with little experience! ★ Fukurina / 18 years old / A transparent orthodox beauty female college student

  • amateur censoredcreampieamateurmfcmfc-075mfc075435mfc-075
    • 2021-02-05
    61 min

    Caribbeancom 020521-001 The Continent Full Of Hot Girls, File.081 Riina Okamoto

  • riina okamoto uncensoredcreampiehandjobcaribbeancom
    • 2021-02-23
    94 min

    428SUKE-062 [Egui Slender Sweet King Boobs] Only Hakata beauty won! !! Introducing a lewd body with strong local love and libido! Boobs are erogenous zones! Blow the tide magnificently and the sensitivity is great! Creampie second round rush with red

  • amateur censoredcreampiebig titssukesuke-062suke062428suke-062
    • 2021-03-22
    118 min

    [AGAV-052]We Challenged This Grown Up Slut To Orgasms And It Completely Transformed Her Personality？ I Knew It, I Like To Be The Little Girl... Tsumugi Narita

  • narita tsumugi censoredbeautiful girlslutAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-052AGAV052agav00052
    • 2021-03-29
    38 min

    362SCOH-041 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [I ● Ya] Ayame Hina

  • amateur censoredcreampieuniformscohscoh-041scoh041362scoh-041
    • 2021-04-15
    148 min

    [SORA-306]Serial Cheater Wife - She Loves Cock So Much She Can't Resist! High On Her Horny Newlywed Lifestyle, She Turns Her Honeymoon Into An Adultery Trip! Going Wild, Cumming Hard, And Fucking Outdoors For 1 Night, 2 Days Of Raw Stranger Dick!

  • ayaka mochizuki censoredsquirtingsingle workSORAyama to sorahimu lockSORA-306SORA306sora00306
    • 2021-04-16
    480 min

    [MTM-015]【期間限定販売】東京23区パコる女たちBEST8時間

  • amateuramateur censoredamateurmtmmtm-015mtm015mtm-015
    • 2021-05-07
    152 min

    [IPX-653]Hot And Steamy Kissing And Sex With A Beautiful Woman Full Of Overflowing Spit And Gushing Saliva Iyona Fujii

  • iyo fujii censoredblowjobslutIPXidea pocketusa pyondishIPX-653IPX653ipx00653
    • 2021-05-21
    120 min

    [JUL-577]Married Woman Secretary's Secret Kisses And Sweaty Sex Behind Closed Doors In Her Boss's Office... The Secret To Her Swift Promotion... Legendary MILF X Director Nagae's First Work! Maiko Ayase

  • maiko ayase maria sawaguchi censoredcreampiemature womanJULmadonnanagaeJUL-577JUL577jul00577
    • 2021-05-23
    63 min

    FC2PPV 1832637 An executive of a fast-growing rumored venture company and a miracle H ❤️❤️ I have vaginal cum shot twice as I desire ❤️❤️

  • amateur uncensoredfc2
    • 2021-05-28
    49 min

    328HMDN-366 Dero Married Woman With A Child Who Flocks On SNS 31 Years Old Erotic Buzzing Mature Milk H Cup Rubbing New Toy Saddle "Gimojiii" Raging Big Cock Portio Thrust Cum Shot Completely Fallen

  • amateur censoredcreampiebig titshmdnhmdn-366hmdn366328hmdn-366
    • 2021-05-29
    59 min

    10musume 052921_01 Get excited with bondage cosplay Miho Saeki

  • amateur uncensored10musume
    • 2021-06-04
    65 min

    FC2PPV 1853074 [No / piece] "I was a virgin until recently // ♡" That short-cut daughter … came back with a pleasant sensation from the man’s blame! ♥ ️ * 2 Large review benefits available

  • amateur uncensoredfc2
    • 2021-06-05
    120 min

    [ANB-189]I Became My Mother-in-law's Sex Toy: Thick Fucking With A Hot Mother-in-law! Yuri Tadokoro

  • yuri tadokoro censoredmature womanslutANBrubysusumu yanokuchinobleANB-189ANB189anb00189
    • 2021-06-05
    108 min

    [AED-194]Family Fun: Creampie Into A 50-something MILF's Pussy Chisato Shoda

  • shota chisato censoredcreampiemature womanAEDrubysusumu yanokuchieden rubyAED-194AED194aed00194
    • 2021-06-18
    69 min

    328HMDN-373 [Millionaire’s Play] Nasty Celebrity Wife 25 Years Old A Beautiful Pussy With 5 Saffles. She is an acme with a nipple licking stakeout piston. Mating that squeezes all sperm from a 20-year-old man

  • amateur censoredcreampiemarried womanhmdnhmdn-373hmdn373328hmdn-373
    • 2021-06-29
    140 min

    [SDAB-188]Athletic girl meets a man on a train on her way to the club and gets jizzed in a scuzzy apartment.

  • don t be quick censoredcreampieschoolgirlSDABsod createakai suiseiseishun jidaiSDAB-188SDAB1881sdab00188
    • 2021-07-20
    109 min

    [OFKU-185]My Bride's Mother, Who Came To Tokyo From Kochi...My Colossally Busty Mother-In-Law From Tosa: Natsuki Fujioka, 51 Years Old

  • natsuki fujioka censoredcreampiemature womanOFKUstar paradisemom railOFKU-185OFKU185h-254ofku00185
    • 2021-07-30
    120 min

    [ATID-474]A Pliable OL Who Drowned In Persistent, Sticky Sex With An Older Man - Madoka Shidzuki

  • madoka shizuki censoredbig titssingle workATIDattackerstakuo ohtaniin madATID-474ATID474atid00474
    • 2021-08-14
    241 min

    [KSBJ-150]Climaxing In Plump Beauties 12 People

  • azusa yagi sachiko ono censoredcreampiemature womanKSBJksb planning emanuelKSBJ-150KSBJ150ksbj00150
    • 2021-08-30
    47 min

    292MY-472 Kamisaki Ayaka 2

  • amateur censoredcreampiebig titsmymy-472my472292my-472
    • 2021-09-04
    137 min

    [BAHP-087]I Became A Porn Actress -Innocent Type College Girl Cums Hard In Porn Debut- Mayu Omikawa

  • mayu komikawa censoredcreampiesingle workBAHPbarutanyoshida daibutsuhoppinBAHP-087BAHP087bahp00087
    • 2021-09-10
    77 min

    [stcv-020]あいな

  • amateur censoredcreampieamateurstcvstcv-020stcv020stcv-020
    • 2021-09-12
    80 min

    413INST-159 [4th Idol] Negotiations Immediately After The Announcement Sex [Skits] Out Raw Squirrel At An Individual Handshake Event With The Idol

  • amateur censoredcreampieuniforminstinst-159inst159413inst-159
    • 2021-09-17
    181 min

    [MIFD-177]Fresh Face Girl Now Has Big G-cup Tits!! Beautiful Girl With A Pretty Face Has A Body That Looks More Mature Than Her Age. AV Debut. Misuzu Mifune

  • mifune misuzu censoredbig titsbeautiful girlMIFDmoodyzusapyonmoodyz freshMIFD-177MIFD177mifd00177
    • 2021-10-02
    227 min

    [SORA-337]A Cum Swallowing Date With A Blowjob Buddy A Meaty And Voluptuous Office Lady Is Seriously Cumming And Pissing Herself Silly! She"s And Exhibitionist, Opening The Golden Shower Floodgates While D***king Down 6 Cum Shots!! Kurumi Tamaki

  • tamaki walnut censoredblowjobsingle workSORAyama to soradenchuuSORA-337SORA337sora00337
    • 2021-10-08
    138 min

    [BBAN-344]We Try Swapping To Make Hot, Lewd Lesbian Couples. Giving Her A Sensual Touch From Another Cute Girl. Hotaru Nogi, Riona Minami , Rui Hizuki, Tsubasa Hachino

  • nogi firefly rina minami censoredlesbianBBANbibianBBAN-344BBAN344bban00344
    • 2021-10-09
    141 min

    [HOKS-103]The Life of a Married Couple in Japan: 48 Tricks Under the Futon

  • matsushima sanae ayaka muto censoredbig titsmature womanHOKSfa pro platinumogurokku kinzoufa proHOKS-103HOKS103hoks00103
    • 2021-10-23
    160 min

    [MADM-147]Miyu Tsubakibara. My Girlfriend"s Mom For My Very First Time. Greeted With Whispers Of Temptation From My Girlfriend"s Mom, Leading Her To Take Me All Day As Her Cherry Boy.

  • miyu tsubakihara censoredcreampieblowjobMADMcrystal eizoumadam maniacMADM-147MADM147madm00147
    • 2021-11-01
    65 min

    SIRO-4658 [First Shot] [Slender E-Cup] [Dramatic Service] A Gorgeous Imadoki College Student With A Sense Of Rear Appears. Active Jd Aiming For A Teaching Profession Is Shy But Exposes A Foolery In Front Of The Camera .. AV Application On The Net → A

  • amateur censoredamateursirosiro-4658siro4658siro-4658
    • 2021-11-05
    118 min

    [JUL-771]Chance Reunion With Sexual Harassment Teacher From S*****t Days as Prostitute. From That Day Made To Become a Subservient Pet... Nana Hayami

  • don t be quick censoredmature womansingle workJULmadonnashouten shirouJUL-771JUL771jul00771
    • 2022-01-08
    52 min

    C0930 ki220109 Tsukasa Nojima 23years old

  • amateur uncensoredc0930
    • 2022-01-08
    119 min

    [KAGP-212]The Best Sluts Can Suck Cock Without Using Their Hands! 4 10 Amateur Girls Give Blowjobs Without Using Their Hands

  • censoredamateurblowjobKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-212KAGP212kagp00212
    • 2022-01-25
    74 min

    200GANA-2633 Seriously Nampa, First Shot. 1749 Picking Up A Short-Haired Older Sister I Met In Tachikawa And Heading To The Hotel! Stroking A Sticky Fair-Skinned Body … In The Afternoon On Weekdays, Men And Women Who Meet For The First Time Meet

  • amateur censoredamateurganagana-2633gana2633200gana-2633



    • Jav Cherry, watch JAV streaming online japanese xxx