tsukasa nagano




FC2MIDVJULNGODNACXIPXHDKANNPJSPRDMIDESTARSSHKDDASDCAWDNACRVENUJUFEVENXDASDABWSQTE

2021-01-15
129 min

[GZAP-039]This Girl Dressed In A Uniform With Black Stockings Was Attending A Self-Defense Class, But She Had Her Guard Down So She Was Easy To Fuck LOL And When I Had My Way With Her Sexually During Training...

  • censoredcreampieschoolgirlGZAPprestigezapGZAP-039GZAP039118gzap00039
    • 2021-01-17
    129 min

    [BDA-132]Black Guys Unleashed! Big Black Rod - Yuka Hirose

  • yuka hirose censoredcreampiedeepthroatBDAbermuda mousouzokuichikan abashiriBDA-132BDA132bda00132
    • 2021-02-11
    155 min

    [HAWA-238]This Amateur Wife Was Handed One Condom And Told To Go To The Home Of A Normal College S*****t And Spend The Night There, But She Wasn't Satisfied With One Jimmy-Covered Fuck So She Let Him Have 2 Creampie Fucks And Gave Him A Cowgirl R

  • censoredbig titsHAWAcosmos eizomountain forestcosmospictures soft on demandHAWA-238HAWA2381hawa00238
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-24
    99 min

    459TEN-013 [Final Weapon H Cup] Bring a god milk gal with maximum destructive power to the hotel! !! Bombshell fuck with gal’s special game underwear! !! The strongest boyne of weight MAX riding on a flat waist is too erotic! !! Put it in, rub i

  • amateur censoredcreampiebig titstenten-013ten013459ten-013
    • 2021-03-05
    87 min

    300MAAN-630 [H-cup god body healing nurse takes down NTR brush] At the request of her boyfriend, while taking off her skin to a man who does not like it, the small devil mode is activated! !! Munyumunyu milk pressure fucking explodes to play with de

  • amateur censoredcreampiebig titsmaanmaan-630maan630300maan-630
    • 2021-03-06
    116 min

    [SSIS-003]I Want To Destroy This Boring Life, My Mind, And My Pussy After 2 Years Of Marriage, My Relationship With My Husband Is On The Rocks, And So I Decided To Commit Infidelity With My Ex-Boyfriend, Because We Had The Greatest Sex Of My Life, An

  • minami kojima censoredsingle workdramaSSISs1 no 1 stylemichiru arashiyamaSSIS-003SSIS003ssis00003
    • 2021-03-06
    477 min

    [OFJE-302]"You Want Me To Make You Cum With Just My Mouth, Right？" Angel Moe's All-Blowjob Service 480 Minutes BEST

  • angel moe censoredblowjobbeautiful girlOFJEs1 no 1 styleOFJE-302OFJE302ofje00302
    • 2021-03-10
    37 min

    [ore-764]モモカ 2

  • amateur censoredcreampieamateuroreore-764ore764ore-764
    • 2021-03-18
    169 min

    [SSIS-020]Mahina Amane In PLATINUM SOAP

  • amane mahina censoredbig titssingle workSSISs1 no 1 stylegoemonSSIS-020SSIS020ssis00020
    • 2021-03-18
    104 min

    300MIUM-676 [Intelligent JD Nasty Awakening! ] Super-brained W college student awakens to true SEX with a thick Ji ● Ko! Crash into a pure white peach butt! Iki voice MAX of tent tremor! !! Oy! Oy! You can hear it outside! !! There is no doubt that a

  • amateur censoredsquirtingamateurmiummium-676mium676300mium-676
    • 2021-03-23
    242 min

    [SHIC-206]Tiny Teens 11 Girls 4 Hours

  • amateur censoredbeautiful girlSHICadolscence.comSHIC-206SHIC206
    • 2021-03-27
    41 min

    FC2PPV 1742950 [First shot / graduation commemoration] 3 shots cum swallowing circle 11 Sakura

  • amateur uncensoredfc2
    • 2021-04-02
    117 min

    [BBAN-319]After The Graduation Ceremony ... A Bittersweet Tale Of Love Between A Newly Graduated S*****t And Her Former Teacher. Suzu Kiyomi Ayano Fuji

  • kiyomiya suzu ayano kato censoredbig titslesbianBBANbibianBBAN-319BBAN319bban00319
    • 2021-04-02
    119 min

    [SSIS-032]The Older Female Coworker I Hate Was Secretly Working At A Super Cheap Public Brothel？! How I Turned The Tables And Shamed Her By Fucking And Deep Throating Her Tsubaki Sannomiya

  • sannomiya tsubaki censoreddeepthroatsingle workSSISs1 no 1 stylezaku araiSSIS-032SSIS032ssis00032
    • 2021-04-08
    74 min

    [230OREC-736]ひな

  • amateur censoredcreampieuniformorecorec-736orec736230orec-736
    • 2021-04-09
    148 min

    [JUFE-278]The Scent Of Sex - Thick, Ropey Saliva And Sex Fluids, Perfect For D***king... The Ultimate Pleasure Cock-Gobbling Massage Parlor Akari Neo

  • akari neo censoredslutsingle workJUFEfitchJUFE-278JUFE278jufe00278
    • 2021-04-13
    60 min

    299EWDX-356 Fair-skinned plump big breasts wife has a lewd sexual desire to catch other sticks in 3 years of marriage

  • amateur censoredbig titsmarried womanewdxewdx-356ewdx356299ewdx-356
    • 2021-04-15
    45 min

    FC2PPV 1770793 [Limited to 3 days, 40 off] [Soft milk banzai] Chinatsu ★ Big breasts married woman ♪ Amazing boobs over the meter! 100cm dripping soft milk I cup milk is rubbed until it is deformed w A man’s yogal face is my favorite ☆ But a slu

  • amateur uncensoredfc2
    • 2021-05-01
    124 min

    [NACR-422]Horny Stepmoms Shihori Endo

  • gloss hall shiori endo bookmark censoredcreampiemature womanNACRplanet plusdirector onanakuruNACR-422NACR422h-237nacr00422
    • 2021-05-07
    159 min

    [MIAA-435]A S*****t-Teacher Reunion: She's Become A Married Woman Now, And She Tries On Her Old Uniform For Him - And Some Creampie Adultery Ai Mukai

  • ai mukai censoredcreampieuniformMIAAmoodyzmametaro mamezawaeveryone s porn starMIAA-435MIAA435miaa00435
    • 2021-05-16
    61 min

    HEYZO 2527 Cum Swallowing MILF – Chihiro Hinata

  • chihiro hinata uncensoredcreampiecumshotheyzo
    • 2021-05-21
    165 min

    [HND-995]The Gross Doctor I Hate Made Me Cheat On My Husband And Fucked Me Raw, And Even Though I Tried To Resist I Couldn't Help But Cumming Over And Over... Mikako Horiuchi

  • mikako horiuchi censoredcreampiesingle workHNDhon nakamametaro mamezawaHND-995HND995hnd00995
    • 2021-05-22
    121 min

    [NSPS-994]She Was Annoying Me So I Fucked Her Wife Gets Soaked Rika Aimi

  • rumi tadami censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-994NSPS994nsps00994
    • 2021-06-04
    52 min

    SIRO-4538 [First shot] [Soaked teacher] A slender cram school teacher who teaches mathematics to junior high school students has appeared. Innocent girlfriend also fascinates a woman’s face when a naughty atmosphere spreads .. Application amateu

  • amateur censoredamateursirosiro-4538siro4538siro-4538
    • 2021-06-12
    135 min

    [BEFG-002]Interrogation Investigator ~ PERSONA ~ Episode 1 Sacrificial Flower Writhes In Agony As She's Caught Up In A Trap Of Torment Ruka Inaba

  • inaba censoredbdsmsingle workBEFGbabyentertainmentkikubongolden babeBEFG-002BEFG002befg00002
    • 2021-07-02
    125 min

    [HODV-21586]Sharing A Room With My Female Boss On A Business Trip I Was Seduced By Another Woman And Made Into A Sex Servant Mere Days After My Wedding Toka Rinne

  • roaring sound censoredcreampiebig titsHODVh m pk c takedaHODV-21586HODV215865642hodv21586
    • 2021-07-14
    65 min

    495MOJ-011 "riko & Arisa" Of A Good Friend Duo With A Lesbian After School Orgy

  • amateur censoreduniformamateurmojmoj-011moj011495moj-011
    • 2021-07-29
    92 min

    [FUGA-049]The Wife Who Will Fuck The Criminal To Get Back Her K****pped Husband: Yuka Mizuno

  • yuka mizuno censoredcreampiemarried womanFUGAcenter villagejiro fukagawaparadise center villageFUGA-049FUGA049h-086fuga00049
    • 2021-07-30
    85 min

    483SGK-035 "Unrivaled Ji ● Po Love" "Innocent Girl In The Country" "Gutchori Wet Wet Constitution" "Ecchi For The First Time In A Year" "Super Do M Ichayo Climax" A Country Girl Working At A Factory From T

  • amateur censoredamateursgksgk-035sgk035483sgk-035
    • 2021-08-17
    140 min

    [STARS-387]A Large Release Of Cum Squirts! Over 35 Cum Shots Squirting To The Max In A Massive Orgasmic Fuck Fest! Anna *Caution: We"ll Luxuriously Show You How Her Pale White Skin Blushes Into An Erotic Pink Complexion! (Overwhelming 4K Video Fo

  • anna censoredsquirtingsoloworkSTARSsod createkashiwakura hiroshisod starSTARS-387STARS387
    • 2021-09-11
    59 min

    HEYZO 2607 Extreme Three Hole Fuck!! – Nana Kamiyama

  • nana kamiyama uncensoredcreampiehandjobheyzo
    • 2021-09-17
    162 min

    [KRU-129]The Panty Shot Rhythm of Mature Women

  • censoredmature womanlingerieKRUkarumagroupKRU-129KRU129kru00129
    • 2021-10-03
    34 min

    233BAT-094 Anju

  • amateur censoredamateurbatbat-094bat094233bat-094
    • 2021-10-08
    170 min

    [IPX-734]Flirtatious Lovestruck Couple Experience: Soothing Deep Kisses, Naughty Techniques, And Endless Sex! Starring Mai Kanami

  • kanna mimai censoredblowjobsingle workIPXidea pocketkyouseitissueIPX-734IPX734ipx00734
    • 2021-10-13
    83 min

    259LUXU-1449 Luxury TV 1469 In Contrast To The Gentle And Gentle Atmosphere, An Older Sister Who Has A Wealth Of One-Night Experience And A Commitment To Physical Compatibility Has Appeared. As She Said, "I Like To Lick", I Tasted The Big Coc

  • amateur censoredbig titsamateurluxuluxu-1449luxu1449259luxu-1449
    • 2021-10-30
    125 min

    [GVH-314]Breaking In the Honor S*****t. A Pregnancy Training Camp Acting Like a Slut. Rina Takase

  • rina takase censoredcreampieschoolgirlGVHglory questkimura hajimeGVH-314GVH314gvh00314
    • 2021-11-04
    101 min

    [AKDL-148]"Study If You Want To Have Sex With Me! Fucked By Private Tutor With Backdoor Option. Reina Usami

  • reina usami censoredcreampiebeautiful girlAKDLaquinoriaquinoriaknrAKDL-148AKDL1481akdl00148
    • 2021-11-06
    132 min

    [SINN-023]Taking Someone"s Lover For A Pregnancy! Seducing An Amazingly Beloved Wife... Record Of A Crazy Scenario With This Terrible Guy Using Her To Get Her Pregnant. (Beautiful Young Wife Who Is Just Too Good - Compilation)

  • censoredcreampieSINNtoaru chihou no.netorasemaniatoaru chihou no.netorasemaniashin sekai mousozokuSINN-023SINN023sinn00023
    • 2021-11-19
    119 min

    [SSIS-241]Forbidden Teacher Love. Yua Mikami

  • yua mikami censoredbig titsslutSSISs1 no 1 stylekyoseiSSIS-241SSIS241ssis00241
    • 2021-12-06
    55 min

    328HMDN-433 [Celebration! !! First Anal] Former Weather Sister Her Cock Addiction Nasty Wife Reappears W Cock 2 Holes Inserting A Twisting Extra Fine Body And Fainting Continuous Acme. Vaginal Wall Gorigori Limit Breakthrough 2 Hole Creampie Acme Hel

  • amateur censoredanalcreampiehmdnhmdn-433hmdn433328hmdn-433
    • 2021-12-09
    67 min

    FC2PPV 2503229 * Limited Special Price [Cuckold] Former Jinnu Candidate, An Affair Date With A Beautiful Dancer Youtuber From Osaka Gei University! Soft Body Gonzo Video Leaked [cen]

  • amateur uncensoredfc2
    • 2021-12-24
    58 min

    [122421-001]Creampie Santa Girl 2021

  • emiri momota uncensoredcreampiehandjobcaribbeancom
    • 2021-12-31
    77 min

    259LUXU-1531 Luxury TV 1503 This Is A Beautiful Appearance! From The Tip Of The Head To The Tip Of The Foot, The Style Is As Good As A Model With A Sense Of Beauty! A Woman On Top Posture That Greets The Stimulation Of Rich Blowjobs And Big Cocks Whi

  • amateur censoredamateurluxuluxu-1531luxu1531259luxu-1531
    • 2022-01-22
    120 min

    [SGM-053]Slippery Mature Woman Lesbian Pleasure Eating Intense And Thick Homosexual Moist Copulation Chisato Shoda , Yu Kawakami

  • shota chisato yu kawakami morino morino censoredbig titslesbianSGMglobal media entertainmentkikujiro akabanesuper global mediaSGM-053SGM053sgm00053
    • 2022-01-27
    115 min

    [FSDSS-356]My Girlfriend"s Panting Voice, Heard From The Next Room - With Ruru Tengoku

  • heaven censoredsingle workFSDSSfalenoboomer 44faleno starFSDSS-356FSDSS3561fsdss00356
    • 2022-01-27
    119 min

    [IESP-691]Kaede Hiiragi Lesbian Unleashed - My Stepmom"s Lesbian Training -

  • hiiragi kaede otsuki sound censoreddramaIESPienergykikuriniespIESP-691IESP6911iesp00691
    • 2022-01-30
    242 min

    [RD-1097]Showa Era Sensual Mature Wives Special, 6 Performers, 4 Hours. A Mature Body Gets Lost In Pleasure While Having Sex Again For The First Time In A While...

  • amateur censoredmarried womanblowjobRDatena eizouRD-1097RD1097
    • 2022-02-04
    64 min

    230OREC-1004 Yu-San, 31 Years Old (Yu Hironaka)

  • amateur censoredcreampiemarried womanorecorec-1004orec1004230orec-1004
    • 2022-02-04
    48 min

    FC2PPV 2645380 [No Personal Photography] The Gap Between The Innocent Face And The Erotic Body Of The Whip Whip Is Irresistible … If You Take It Off, It’s Amazing F Cup Huge Breasts! !! The Soft Skin Of A Naive And Neat Active Female Colleg

  • amateur uncensoredfc2
    • 2022-02-11
    40 min

    520SSK-047 Yui (Yui Hazuki)

  • amateur censoredcreampiesquirtingsskssk-047ssk047520ssk-047
    • 2022-02-19
    120 min

    [JSOP-011]The New "Beautiful Mature Woman At The Public Bathhouse." High Class Bathhouse For Passionate And Sticky Encounters. Arisa Shitara

  • shitara arisa censoredmature womansingle workJSOPglobal media entertainmentyayoi nakanomature japanese soaplandJSOP-011JSOP011jsop00011
    • 2022-03-04
    130 min

    [NKKD-247]The Instant My Wife Flips Her Switch ... When This Skilled Finger Technician Relentlessly Teased Her Most Sensitive Love Organ, It Kept Ringing Her Bell ... Hikari Kisaki

  • hikari hime censoredcreampiesingle workNKKDjet eizomanji groupNKKD-247NKKD247nkkd00247
    • 2022-03-05
    36 min

    FC2PPV 2698917 [First Shot / Appearance! !! ] Limited Until Tomorrow! [New Cinema Style] A Healthy Cafe Clerk Who Earns A Living While Caring For His Grandfather. !! Further Facial Cumshots! !! !! (3 Times Ejaculation)

  • amateur uncensoredfc2
    • 2022-03-15
    88 min

    [ACZ-084]I Was Breaking In This Girl To Be A Semen-Processing Sex Doll Ever Since She Was A Virgin Hitomi (Bitch Hole Hospitality)

  • censoredbeautiful girlbdsmACZsanwa publishingabnormal.companiesACZ-084ACZ084h-019acz00084
    • 2022-03-19
    240 min

    SCOP-763 Slutty Gal And An Intense Delinquent Lover. 51 Performers, Creampie SEX, 4 Hours, BEST.

  • censoredslutSCOPscooptaro kSCOP-763SCOP763scop00763



    • Jav Cherry, watch JAV streaming online japanese xxx