three u




FC2IPXHODVAVSACAWDSHKDMILKMARASSISNACRAPODHUNTBCESDMIDVHMNFSDSSSANVENUSDABABWVENX

2020-11-26
100 min

[RCTD-366]Rock Hard Hermaphrodite A Story Of Seduction

  • yurika nakajo canon censoredbig titslesbianRCTDrocketroute yamazakiRCTD-366RCTD3661rctd00366
    • 2020-11-27
    81 min

    259LUXU-1345 Luxury TV 1332 An influencer who sends out trends on SNS appears for the first time in AV with a tense look! A beautiful woman with elegant standing behavior becomes sensitive as soon as the switch is turned on! The secret part overflows

  • amateur censoredamateurluxuluxu-1345luxu1345259luxu-1345
    • 2020-11-29

    FC2PPV 1588074 Limited number [No] Male experience continuous vaginal cum shot to one nursing student (47 minutes)

  • amateur uncensoredfc2
    • 2020-12-01
    99 min

    [SHMO-176]Venus Terme/Ryoko Maki

  • maki ryouko censoredsoloworkSHMOorustak softSHMO-176SHMO176
    • 2020-12-06
    158 min

    [SORA-285]This Maso And Lusty And Aggressive Lolita Little Bitch Is Prepared To Be Shamed And Volunteering For Breaking In Training! (She Wants To Expose Her Pig-Faced Shame) (Deep Reverse Irrumatio) (Big Dick Threesome G*******ging Sex) (Shameful Go

  • chiharu miyazawa censoreddeepthroatsingle workSORAyama to sorausubashisuiSORA-285SORA285sora00285
    • 2020-12-12
    68 min

    200GANA-2404 Seriously Nampa, first shot. 1567 I haven’t had an affair with my husband, and I have never had an affair! Picking up a married woman who has excess libido in Meguro! I knew it was a good idea, but I couldn’t resist my instinct

  • amateur censoredbig titsmarried womanganagana-2404gana2404200gana-2404
    • 2020-12-27
    48 min

    H4610 ori1744 Sayaka Arahashi 20years old

  • amateur uncensoredh4610
    • 2021-01-01
    66 min

    DIZ-012 Minami

  • amateur censoredcreampiebig titsdizdiz-012diz012diz-012
    • 2021-01-01
    241 min

    [JNK-002]S********l Sex POV Junction vol. 2

  • censoredcreampieuniformJNKprestigejunktionJNK-002JNK002118jnk00002
    • 2021-01-06
    73 min

    FC2PPV 1634443 [Personal shooting / set sale] The body of a 43-year-old mature wife is full of brilliance after ripeness.

  • amateur uncensoredfc2
    • 2021-01-09
    150 min

    [EBOD-796]She Gets Looser When She's Had Liquor - I Scored A Babe (In Her 20s) With Colossal Tits At A Bar And Took Her Home For A Raw Fuck (<3)

  • censoredcreampiebig titsEBODe bodyyurukoEBOD-796EBOD796ebod00796
    • 2021-01-16
    21 min

    H4610 ki210116 piddle

  • amateur uncensoredh4610
    • 2021-01-28
    58 min

    FC2PPV 1662866 [No] [500pt OFF until 1/31] Sexless 48-year-old married woman mature woman ❤️ Pleasure taste to another stick full of blood flow for the first time in 3 years ❤️ Large amount of vaginal cum shot with vaginal cum shot ❤️ * Review privil

  • amateur uncensoredfc2
    • 2021-01-30
    273 min

    [RD-1040]She Looks Innocent But Her Bush Is Thick Married Woman And Mature Woman Babes 16 Super Select Ladies 270 Minutes A Filthy Adult Video "Ma'am, You're Pretending To Not Like It, But You're Leaking Pussy Juice Like A Leaky Fauce

  • censoredmarried womanmature womanRDathena videoathenaRD-1040RD1040149rd01040
    • 2021-01-31
    140 min

    [MMUS-048]Young Beautiful Succubus Rei Kuruki

  • satoshi kuruki censoredcosplayslutMMUSmarrionkijin kasaikcpMMUS-048MMUS048mmus00048
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-21
    129 min

    [CAWD-179]"Teacher, Do You Not Like Me？" That Day, I Gave In To My S*****t's Temptation, And Crossed That Forbidden Line ... - I Can Never Tell My Wife About The Forbidden Creampie Sex We Had - Yui Amane

  • amane yui censoredcreampieschoolgirlCAWDkawaiijo asagiriCAWD-179CAWD179cawd00179
    • 2021-02-28
    127 min

    [EMBZ-221][Viewers Be Warned] G*******g Footage Uncut And Unedited - The Raw Record Of A Woman Fucked Hard And Her Flesh Bruised And Shamed! This Baby-Faced Married Woman WIth Colossal Tits Is Dazed By Chloroform And Stun Gun, Cumming And Convulsing

  • honami akagi censoredcreampiemature womanEMBZjukujojuku emmanuellejukujo jukuEMBZ-221EMBZ221embz00221
    • 2021-03-17
    67 min

    [opcyn-159]ねんね(19)

  • amateur censoredbig titsamateuropcynopcyn-159opcyn159opcyn-159
    • 2021-03-26
    177 min

    [ABW-070]Ah, The Spring Of Youth Spend 3 Fucks Of Your Sexual Youth WIth A Beautiful Y********l In Uniform In This Totally POV Video #03 4 Youthful Grafitti Episodes Of Sex And Bittersweet Love, All Experienced Through Your Eyes 175 Minutes Non Nonou

  • nonoura warm censoredcosplaysingle workABWprestigeshiko tissue fuwafuwaabsolutely wonderfulABW-070ABW070118abw00070
    • 2021-04-09
    180 min

    [IPX-647]Shocking News! Independent Porn Actress Tsumugi Akari Investigates The Brothels Everybody's Talking About: Night Clubs! Hostess Bars! BDSM Clubs! Erotic Massage Parlors! Swingers' Parties, And More - She Throws Her Whole Body Into He

  • akari tsumugi censoredbeautiful girlslutIPXidea pocketinjan kogadishIPX-647IPX647ipx00647
    • 2021-04-13
    138 min

    [KIRE-032]Her Slender Body Radiates With Overwhelming Beauty An Intellectual Woman With A Bottomless Well Of Lust. At The Hotel, All We Did Was Fuck. A Real-Life Apparel Designer Kozue Minami 26 Years Old

  • minami kozue censoredsingle workKIREsod createcompany matsuobeauty kirei sodKIRE-032KIRE0321kire00032
    • 2021-04-26
    59 min

    FC2PPV 1788494 [Individual shooting] ＃ 57 C Prefectural ① Active daddy activity living alone from spring J 〇 Affair father of demon libido and Gonzo after school at the hotel [Limited]

  • amateur uncensoredfc2
    • 2021-04-30
    63 min

    328HMDN-358 [Individual] Breastfeeding wife 43 years old and cloudy Gonzo. Personal shooting that is mercilessly vaginal cum shot in the hole after childbirth and spree while dripping milk

  • amateur censoredcreampiemarried womanhmdnhmdn-358hmdn358328hmdn-358
    • 2021-05-08
    196 min

    [SABA-693]10 Of The Highest Raking Amateur Babes In Totally Exclusive Footage In This Collector's Edition! Orgasmic Piston-Pounding Dildo Masturbation, All The Way To The Hilt 8

  • censoredamateurSABAclass s amateurSABA-693SABA693saba00693
    • 2021-05-10
    54 min

    358WITH-100 Arisa (20) S-Cute With Girl Who Wants To See Touched And Gonzo H

  • amateur censoredcreampiesquirtingwithwith-100with100358with-100
    • 2021-05-21
    119 min

    [NNPJ-451]She Wants More Fuckbuddies - Amateur Uses A Dating App To Fun More Men Who'll Fuck Her - Creampie Sex From Dusk Until Dawn In Shibuya Riria

  • censoredcreampieNNPJnanpa japanNNPJ-451NNPJ451nnpj00451
    • 2021-05-22
    52 min

    FC2PPV 1831180 [God work] The result of renting the No. 1 active lady for one day … [Part 2]

  • amateur uncensoredfc2
    • 2021-05-25
    60 min

    HEYZO 2532 Cum Swallowing Girl – Yuka Ohashi

  • yuka ohashi uncensoredcreampieblowjobheyzo
    • 2021-06-02

    FC2PPV 1849089 Limited price until 7th [Uncensored] Get out of the OL work of glasses and cum inside a secret meeting at the hotel

  • amateur uncensoredfc2
    • 2021-06-12
    121 min

    [MDTM-731]Complete POV Quickie Impregnation Fucking Submissive Maid Kurumi Momota

  • hyakuta walnut censoredcreampieblowjobMDTMuchu kikakutodoMDTM-731MDTM731mdtm00731
    • 2021-06-17
    61 min

    1Pondo 061721_001 Braless Neighbor In The Morning: Mai Amao

  • amateur uncensored1pondo
    • 2021-06-18
    115 min

    [PARATHD-3198]I Found Out My Female Boss At Work Is Secretly An Escort And Convincing Her To Have Sex - Highlights

  • censoredbig titsamateurPARATHDparadise tvPARATHD-3198PARATHD3198parathd03198
    • 2021-06-30
    118 min

    [RD-1062]An Innocent Mature Woman Gets Pressured By Her Son's Soccer Coach - Reunited With Her Old Classmate After 44 Years, He Fucks Her In Both Holes...

  • madoka kase yori sorami censoredmarried womanblowjobRDathena videomurayamaathenaRD-1062RD1062149rd01062
    • 2021-06-30
    48 min

    475SKCK-037 Satsuki 2

  • amateur censoredanalamateurskckskck-037skck037475skck-037
    • 2021-07-09
    52 min

    ZOCT-011 Monami (Pornstar Name)

  • amateur censoredcreampieamateurzoctzoct-011zoct011zoct-011
    • 2021-07-09
    149 min

    [MIAA-467]Gyaru Who Wants Pocket Money Won't Stop Fucking Even When He Cums, An Incredible 10 Creampies Without Taking It Out Ranka

  • ranka censoredcreampieblowjobMIAAmoodyztakarase hironoriminna no kikatanMIAA-467MIAA467miaa00467
    • 2021-07-14
    251 min

    [SSIS-161]A Previously Unreleased Premium Edition! Pleasure! First Experiences 8 We'll Show You Plenty Of Saika Having Plenty Of Sex 3 Fucks A 240-Minute Special Saika Kawakita

  • ayaka hebei censoredbeautiful girlsingle workSSISs1 no 1 stylekyoseiSSIS-161SSIS161ssis00161
    • 2021-08-11
    56 min

    016DHT-0290 Bankrupt Eros Shizuka Kanai 41 Years Old

  • amateur censoredmarried womansquirtingdhtdht-0290dht0290016dht-0290
    • 2021-08-26
    121 min

    [RCTD-419]The Queen"s Wrestling Ring, Vol. 5 - The Desired Underground Women"s Pro Lesbian Wrestling -

  • nanako miyamura star ameri censoredlesbianRCTDrocketkambe tarouRCTD-419RCTD4191rctd00419
    • 2021-09-09
    121 min

    [GUN-758]I Want To Lick Their Toes Until Its All Wrinkley! VI Running Shoes Edition

  • misaki azusa marina saito censoredbukkakeGUNradixmg yukkypreeminentGUN-758GUN758433gun00758
    • 2021-09-09
    120 min

    [FSDSS-312]Reborn Debut Her Amazing And Shimmering Top-Class Waist Between Her Beautiful Tits And Ass. Ruru Amakuni

  • heave censoredcosplayFSDSSfalenoboomer 44faleno starFSDSS-312FSDSS3121fsdss00312
    • 2021-09-11
    350 min

    [SCPX-432]No...Father-In-Law!! Please, Stop...These Wives Get Their Father-In-Law"s Massive Cocks Inserted Into Them While S******g Next To Their Husbands And Have An Amazing Climax 2 Discs 350 Minutes 8 Girls

  • censoredcreampieblowjobSCPXk m producehasshiscoop kmpSCPX-432SCPX432scpx00432
    • 2021-09-12
    15 min

    10musume 091221_01 Secret Pussy Collection: Yui Asakawa 2

  • amateur uncensored10musume
    • 2021-09-23
    21 min

    FC2PPV 2237019 [Face Exposure] Slender Fair-Skinned Neat Wife. Call Her Friend And Force Multiple People To Commit In A Public Toilet. We Are Distributing 3p Video Of Face Exposure As A Privilege. (2 Works Total 84 Minutes)

  • amateur uncensoredfc2
    • 2021-09-26
    104 min

    390JNT-029 [Advent! Idol-Class Lee ● Star Glamor] Lee ● Sns Picking Up A Huge Breasts Cosplayer Who Puts Erotic Selfies On The Star! !! The Dream Maid Coffee Shop Clerk Who Connects With Customers Is Yariman Gal With Over 50 Saffle! It Is An Uncontro

  • amateur censoredcreampiebig titsjntjnt-029jnt029390jnt-029
    • 2021-10-07
    190 min

    [MOGI-003]はにかみボーイッシュの短髪乙女 初音あきら(仮)21歳 AVデビュー

  • censoredsoloworkMOGIsod createsaijou akiramogitateMOGI-003MOGI003
    • 2021-10-08
    120 min

    [JUL-737]母の友人 風間ゆみ

  • kazama yumi censoredbig titsmature womanJULmadonnakawaijou osamuJUL-737JUL737jul00737
    • 2021-10-14
    70 min

    OREX-305 Mao 2 (Mao Hamasaki)

  • amateur censoredcreampieamateurorexorex-305orex305orex-305
    • 2021-11-12
    91 min

    SMUK-073 Kanna (Kanna Shiraishi)

  • amateur censoredcreampieuniformsmuksmuk-073smuk073smuk-073
    • 2021-11-19
    83 min

    [HEYZO-2670]YUMA MIYAZAKI Newly Wed Wife"s Double Penetration Part 1

  • yuma miyazaki uncensoredheyzo
    • 2021-11-20
    241 min

    [MDBK-209]BAZOOKA LEGENDARY ACTRESS Asahi Mizuno PREMIUM BEST

  • mizuno chaoyang censoredcreampiebig titsMDBKbazookak taroMDBK-209MDBK209mdbk00209
    • 2021-11-27
    123 min

    [JKSR-518]10AM: What Happened To School...Asuka - Asuka Momose

  • momose asuka censoredcreampiebeautiful girlJKSRbigmorkalobockeypinkjunkyJKSR-518JKSR51857jksr00518
    • 2021-11-28
    58 min

    [HEYZO-2664]Noriko Sasaki Nonstop Sexual Orgasm

  • noriko sasaki uncensoredcreampiehandjobheyzo
    • 2021-12-07
    39 min

    494SIKA-128 Make An Active Actress Drink An Aphrodisiac And Make A Vaginal Cum Shot 3P

  • amateur censoredamateursikasika-128sika128494sika-128
    • 2021-12-18
    31 min

    FC2PPV 2526821 Supporting A Big Tits Cafe Clerk Chasing A Dream. Naked Apron Creampie * Year-End Support Special Price

  • amateur uncensoredfc2



    • Jav Cherry, watch JAV streaming online japanese xxx