natsu tojo




FC2SQTEPPPDMEYDMIDVNACRMARAAVSADASDADNAMBIAUKGAWDJUFESSISSPRDKSBJIPXNATRVEMAAUKG

2020-09-20
117 min

[JUL-318]Madonna Exclusive 2nd Round!! Creampie Revealed!! Losing Her Mind In The Heatwave, This Stepmom Has A Sweaty Adulterous Fuck When Returning Home. Nanako Ise

  • nanako seto censoredcreampiemature womanJULmadonnamametaro mamezawaJUL-318JUL318jul00318
    • 2020-09-26
    118 min

    [MIAA-319]My C***dhood Friend Rescued Me, But when She Was Getting Fucked By Bullies, All I Could Do Was Watch With An Erection Rin Kira

  • kira rin censoredcreampiesingle workMIAAmoodyzshiro shoteneveryone s porn starMIAA-319MIAA319miaa00319
    • 2020-10-03
    120 min

    [PRTD-029]An International Investigator Gets Pumped To Orgasmic Ecstasy With Black Magnum Cocks In A Creampie Hellhole Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsPRTDpremiumhiromichi hosethe strong and noble beautiesPRTD-029PRTD029prtd00029
    • 2020-10-13
    30 min

    FC2PPV 1533175 Until today ・ Double-barreled [Individual shooting] Private general course ③ Back dirt girls. Gonzo a tight pussy.

  • amateur uncensoredfc2
    • 2020-10-17
    44 min

    FC2PPV 1537056 [Individual shooting] A young lady aiming for music college J-type back dirt round light! A quiet child changes completely and erotic mode is fully opened! It feels too good and a lot of vaginal cum shot in a narrow pussy! [Appearance]

  • amateur uncensoredfc2
    • 2020-10-20
    180 min

    [OFKU-164]While His Wife Was Out Of The House And In The Hospital... When He Saw His Stepmom, Who Was Wearing Quite Erotic Lingerie For A Woman In Her Forties, This Son-In-Law Got Hot And Horny And Decided To Bump Uglies With Her LOL

  • censoredcreampiemature womanOFKUstar paradisemom railOFKU-164OFKU164h-254ofku00164
    • 2020-10-22
    72 min

    [hoi-136]桃(19)

  • amateur censoredamateurcosplayhoihoi-136hoi136hoi-136
    • 2020-11-04
    45 min

    FC2PPV 1557709 Yamato Nadeshiko, who works at a long-established Japanese confectionery store, likes to be pierced in the back ❤️ I wrapped a geki piss & a large amount of white bean paste in a nasty body of excitement ❤️❤️ With a souvenir ❤️

  • amateur uncensoredfc2
    • 2020-11-07
    119 min

    [JRW-023]True Stories About The All-Nude Inn 18 After Excessively Worrying About Their Online Reputation, This Young Madam Decided To Provide Excessive Hospitality In Order To Satisfy Every Man's Desire, At This Excessively Erotic Hot Spring Reso

  • kohinata mai aya mamiya censoredmature womanslutJRWrubysukeroku katouJRW-023JRW023jrw00023
    • 2020-11-12
    60 min

    [NYH-057]My Cousin Had Grown Into A Woman With Big Tits, And When I Met Her Again For The First Time In Years, We Decided To Sumo Wrestle, And I Could See Her Panties Poking Out From Underneath Her Miniskirt, And My Heart Started Pounding Like Crazy.

  • nonomiya misato censoredbig titsNYHdirectorsdirectorsnyanjiang houseNYH-057NYH0571nyh00057
    • 2020-11-13
    92 min

    [XRW-944]How To Turn An Office Lady Picked Up From A Dating Site Into Your Fuck Buddy Through Sex Management: The Kaede Case - Kaede Ito

  • kaede ito censoredblowjobsingle workXRWreal worksreal real worksXRW-944XRW944172xrw00944
    • 2020-11-16
    140 min

    [MXGS-1160]A Filthy Beauty Salon Where A Cute Little Devil Works Aoi Kururugi

  • aoi kururugi censoredbeautiful girlsingle workMXGSmaxingkeiha nobuyoMXGS-1160MXGS1160h-068mxgs01160
    • 2020-11-23
    167 min

    [CESD-948]AV Document: Chiharu Miyazawa's All-Day Full-Out Partying!

  • chiharu miyazawa censoredcreampiemature womanCESDceleb no tomoCESD-948CESD948cesd00948
    • 2020-11-30
    241 min

    [RD-1027]MILFs Get Naked On Camera For The First Time - 6 Mature Girls, 4 Hours - MILFs In Their Fifties And Sixties With Sparse Pubic Hair -See Their Whole Pussy And Anal Holes

  • censoredmarried womanmature womanRDathena videoathenaRD-1027RD1027149rd01027
    • 2020-12-01
    120 min

    [NACR-375]Father-In-Law Falls For His Son's Wife Ayaka Mochizuki

  • ayaka mochizuki censoredcreampiebig titsNACRplanet pluscherryshichidomeNACR-375NACR375h-237nacr00375
    • 2020-12-13
    41 min

    FC2PPV 1605469 [Uncensored] Sakura-chan, who is about to graduate ☆ Unearthed thing Part5‼ Icharab SEX was supposed to be a senior intrusion and a 3P continuous live party ♡ [Luxury purchase privilege available]

  • amateur uncensoredfc2
    • 2020-12-21
    76 min

    [THNIB-067]Graduation, Full Open Story, Rose Tinted Memories/Arisa Hirono

  • censoredbig titsbeautiful girlTHNIBintec incTHNIB-067THNIB067h-706thnib00067
    • 2021-01-01
    122 min

    [ENFD-4334]星那 美月/蜜月

  • honami mizuki censoredsingle workENFDe.net frontierENFD-4334ENFD43345664enfd04334
    • 2021-01-15
    63 min

    300NTK-501 Reiwa No.1 Miss Kyaba Advent! !! If you insert a beautiful girl who is serving customers nowadays with a raw chin …! !! Slender beauty body shakes and warps Keiren continuous ascension! !! Echiechi sexual intercourse recording video o

  • nosex censoredcreampieamateurntkntk-501ntk501300ntk-501
    • 2021-01-17
    151 min

    [CHCH-003]Due To Corona This Brothel Babe Is Running A Soapland Right Out Of Her Own Home! - Voluptuous Curves, Incredible Sex SK**ls, And Comfortable, Caring Services Make Her The Talk Of The Town -

  • censoredbig titsamateurCHCHmilk and moms emmanuellemilk and momsCHCH-003CHCH003chch00003
    • 2021-01-29
    302 min

    [MKMP-377]Uta Yumemite Dream History [Legend]

  • yumemi teruuta censoredbeautiful girlsingle workMKMPk m producek taromillionMKMP-377MKMP37784mkmp00377
    • 2021-02-02
    55 min

    1Pondo 020221_001 Sexy Lingerie Kaori Mizuno

  • amateur uncensored1pondo
    • 2021-02-05
    482 min

    [PPT-105]Minamo Nagase 8-Hour BEST PRESTIGE PREMIUM TREASURE Vol. 03 - All 6 Titles By "Minamo Nagase" Permanently Preserved In This Collector's Edition!

  • minase nagase censoredcreampiebig titsPPTprestigeprestige premium treasurePPT-105PPT105118ppt00105
    • 2021-02-11
    130 min

    [RCTD-383]Aphrodisiac: Fallen Undercover Investigator - Shoko Akase

  • naoko akase censoredbig titsmature womanRCTDrocketcentral yamamotoRCTD-383RCTD3831rctd00383
    • 2021-02-12
    135 min

    [BOKD-213]Natural Crossdresser: Breaking In Debut - Current University S*****t, Rika

  • rika censoredcreampieBOKDour man s daughterdorkawaBOKD-213BOKD213h-995bokd00213
    • 2021-02-21
    122 min

    [JUL-483]Only For Me!! A Compliant Married Woman Creampie Paid! Your Step-uncle's Orders Must Be Totally Obeyed! Days Of Pregnancy Breaking In. Mao Watanabe

  • mao watanabe censoredcreampiemature womanJULmadonnarokusaburo mishimaJUL-483JUL483jul00483
    • 2021-03-04
    65 min

    336KNB-144 Please hit your ass a lot! De M fair-skinned wife appears in AV because of sexlessness with her husband! !! Massive vaginal cum shot with raw insertion from slimy tech show with lotion play! !! !! I will take a gonzo with this married woma

  • amateur censoredcreampiemarried womanknbknb-144knb144336knb-144
    • 2021-03-04

    FC2PPV 1710558 Limited number [Uncensored] Night aquarium date with nursery teacher and continuous vaginal cum shot (88 minutes)

  • amateur uncensoredfc2
    • 2021-03-30
    115 min

    [RD-1046]Mature Wives - Housekeeper In Her Fifties Falls Prey To Her Employer - Mourning Wife Ravished By Her Brother-In-Law On The Morning Of Her Husband's Funeral

  • yori sorami sanada sanako censoredmarried womanblowjobRDathena videomurayamaathenaRD-1046RD1046149rd01046
    • 2021-04-26
    63 min

    SIRO-4503 [First shot] [Slender standing back] [Make your abs jerk ..] Active JD with an innocent smile. She does not look good on her face and fascinates her daring way of dying, she panting with her standing back that fascinated her long legs .. AV

  • amateur censoredsquirtingamateursirosiro-4503siro4503siro-4503
    • 2021-05-01
    189 min

    [BBAN-324]Female Teacher Lesbian Sex Servant H

  • yuri sasahara chiharu miyazawa censoredlesbianbdsmBBANbibianBBAN-324BBAN324bban00324
    • 2021-06-04
    86 min

    483SGK-027 [Neat and clean sensitive pastry chef] [Beautiful back, beautiful constriction, nice ass! ] [Tall 169 cm transcendent erotic good body] [Set his Kusless frustration] [Crying climax] Sexless with my boyfriend living together for 4 months! A

  • amateur censoredbig titsamateursgksgk-027sgk027483sgk-027
    • 2021-06-04
    116 min

    [JBD-268]Miserable Young Wife Chiharu Miyasawa

  • chiharu miyazawa censoredsingle workJBDattackershana kanojabakuJBD-268JBD268jbd00268
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-22
    41 min

    FC2PPV 1882520 [No] [Limited to 100 pieces 2980 → OFF to 1480pt!] A certain fashion magazine reading mode finalist! Advent ♥ ️ I love naughty things! ♥ ️ * Review benefits / Sexy underwear masturbation

  • amateur uncensoredfc2
    • 2021-07-06
    56 min

    188HINT-0465 Yuna

  • amateur censoredcreampiemarried womanhinthint-0465hint0465188hint-0465
    • 2021-07-07
    70 min

    ION-090 Kotone

  • amateur censoredsquirtingamateurionion-090ion090ion-090
    • 2021-07-08
    121 min

    [FSDSS-251]An Aphrodisiac Raises Sexual Desire To The Limit Before The Shoot Begins. Insatiable Lust And Pleasure. Sora Amakawa

  • tenkawa sora censoredbig titsblowjobFSDSSfalenowild sevenfaleno starFSDSS-251FSDSS2511fsdss00251
    • 2021-07-29
    74 min

    FC2PPV 1945219 A 10-Year-Old Girl Until 3 Days Ago. She Changed Completely From Her Expression With Sorrow. She Thrusts Her Cock Into Her Throat And Her Full Erection Is Inevitable. Sex Seeded On An Immature Body That Was Used As An Outlet For Uncle&

  • amateur uncensoredfc2
    • 2021-08-14
    121 min

    [KAGP-192]You Can See The Shape Of Their Pussies - These Girls" Delicate Panties Get Wet With Pussy Juice When They Jerk Themselves Off 6

  • censoredamateurbeautiful girlKAGPkaguya hime pt mousozokutsumatori no okinakaguya hime ptKAGP-192KAGP192kagp00192
    • 2021-09-09
    120 min

    [DLDSS-025]"Hey, I Want To Taste Your Cock." She Doesn"t Comply. A Beautiful Lewd Girl In A Peaceful Workplace. Suzume Mino

  • suzume mino censoredbig titsblowjobDLDSSdahliakei isoiDLDSS-025DLDSS0251dldss00025
    • 2021-09-13
    60 min

    SIRO-4627 [First Shot] [Fair-Skinned Beautiful Breasts] [Muchimuchi Nice Ass] A Sweet Lady Who Can See The Goodness Of Growing Up Appears. Gaze At The Man With Enchanted Eyes And Shake The Big Tits And Nice Ass To The Cock That Sticks To The Back ..

  • amateur censoredbig titsamateursirosiro-4627siro4627siro-4627
    • 2021-09-20
    88 min

    [YOZ-388]From Tokyo! Mature Woman Lingerie Special Prostitution, Raw Sex Negotiation

  • misa kyono satomi someya censoredmature womanlingerieYOZstar paradiseyoru ouzokuYOZ-388YOZ388h-254yoz00388
    • 2021-09-22
    109 min

    435MFC-143 [Plump Squirting Monster] Super-Dreadnought Big Pie & Big Bucket Whip Whip Beauty And Vaginal Back Gun Thrust Power Sex! !! !! It Feels So Good That My Legs Are Peen And Wide Open ♪ Saddle Tide Joba Joba 3 Consecutive Battles Of Rich Se

  • amateur censoredcreampiebig titsmfcmfc-143mfc143435mfc-143
    • 2021-09-23
    47 min

    10musume 092321_01 The Girl On The White Bikini Suit, Swallowing Semen Hibiki Sakurano

  • amateur uncensored10musume
    • 2021-10-01
    149 min

    [MIAA-507]My Slutty Stepdaughters Came To Visit And Do Their Mother"s Part While I Was Working Away From Home, Starring Lala Kudo and Rina Takase

  • lara kudo rina takase censoredcreampiebeautiful girlMIAAmoodyztakarase hironoriminna no kikatanMIAA-507MIAA507miaa00507
    • 2021-10-03
    126 min

    300MIUM-744 [Final Weapon Icup] Rent An Older Sister With Huge Breasts As Her! Completely Rec The Whole Story That Was Spoiled Up To The Originally Prohibited Erotic Acts By Persuading! !! After Enjoying A Pool Date In A Swimsuit, Icha Love Lover Sex

  • amateur censoredcreampiebig titsmiummium-744mium744300mium-744
    • 2021-11-19
    238 min

    [CJOB-099]Nympho Harem where They Scramble to do Blowjobs - They Take Turns Coming After Me and Sucking My Dick and Making Me Come Over and Over - The BEST Picks

  • ichika matsumoto aoi kururugi censoredblowjobslutCJOBchijo heavenslut heaven bestCJOB-099CJOB099cjob00099
    • 2021-12-23
    150 min

    [MTALL-006]NTR Titties ~ Step Mom Has Her Tits Sucked In Front Of Her Step Son By The Neighbor ~ Sachiko

  • sachiko censoredbig titsmarried womanMTALLmateriallultimate ryoMTALL-006MTALL006
    • 2021-12-31
    58 min

    FC2PPV 2559379 Yurufua-Chan [Successful Capture] I Was Excited By The Appearance That It Became Beautiful Every Time I Met, I Just Rushed Into A Love Hotel And It Was A Vaginal Cum Shot From A Periscope In The Bath

  • amateur uncensoredfc2
    • 2022-01-25
    63 min

    SIRO-4768 [First Shot] [Sensitive Body With Generalized Erogenous Zone] [Dedicated Service] Discovered A Clothing Designer With 167 Cm Tall Looks And Beautiful Breasts. While Inserting The Hard Root That Became Hard By Rich Service To The Back Of The

  • amateur censoredamateursirosiro-4768siro4768siro-4768
    • 2022-01-28
    115 min

    [CAWD-340]I Just Want To Be Loved..." As A Result, I"ve Been Treated Like A Convenient Woman, But I"ve Become Addicted To Her Single-mindedness And Erotic Techniques. Minori Kawanami

  • real village henan censoredcreampiebeautiful girlCAWDkawaiitake dCAWD-340CAWD340cawd00340
    • 2022-01-29
    130 min

    [SOAV-085]The Infidelity Of A Married Woman - Minami Hironaka

  • hironaka minami censoredsingle workSOAVhitodzumaengokai emanuelkiiroi hyouSOAV-085SOAV085soav00085
    • 2022-02-05
    123 min

    [BACN-042]Prostitute, Slut, X, Woman. - The Story Of A Girl With Issues Who Lives By Selling Her Body - Lala Kudo

  • lara kudo censoredslutsingle workBACNbaltandaibutsu yoshidacandyBACN-042BACN042bacn00042
    • 2022-02-05
    240 min

    [YLWN-202]"It"s A Secret To The Other Customers, You Know", Real Peeping Of Negotiations With A Married Health Worker! 240 Minutes

  • censoredamateurYLWNyellow moonpappan tateishiYLWN-202YLWN202ylwn00202
    • 2022-02-25
    119 min

    [MIDV-061]輪●されイキまくってしまった過敏な女教師 琴音華

  • kotoneka censoreddeepthroatsingle workMIDVmoodyzhirokoji osakimoodyz divaMIDV-061MIDV061midv00061



    • Jav Cherry, watch JAV streaming online japanese xxx