candy




FC2BBANMILKCAWDFSDSSPREDMVSDDASDAVSAJULKSBJAWDAUKGPPPDROYDMARANGODRBDMEYDAUKSDASD

2021-01-15
205 min

[BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-16
    119 min

    [SSNI-974]Penetrate! Mahina Amane And Her Marshmallow-Soft G-Cup Titties Are Working At A Titty Pub Bar, And We're Going In Undercover! We're Going To Fondle And Suck And Slurp Those Titties In This Big-Time Hustling Hospitality Special

  • amane mahina censoredbig titsbeautiful girlSSNIs1 no 1 stylezampaSSNI-974SSNI974ssni00974
    • 2021-01-28
    52 min

    326HGP-015 [Strangling plea x Mazoiki] [Ecstatic pissing] Super beautiful style married woman with bad drinking and man habits! !! Dirty housewife who is married but catches a man at a joint party is de M nature bare libido elimination raw vaginal cu

  • amateur censoredcreampiemarried womanhgphgp-015hgp015326hgp-015
    • 2021-02-01
    148 min

    [DKWT-006]Young Wife's Delicious Pantyhose: Aoi, 27 Years Old, 3rd Year Of Marriage

  • censoredsquirtingDKWToffice k sDKWT-006DKWT00636dkwt00006
    • 2021-02-06
    121 min

    [SSNI-979]I'm At A Premature Ejaculation Improvement Clinic, But For Some Reason I'm Receiving Relentlessly Teasing Soapland Plays, And It's Giving Me A Serious Hard On... I Eventually Lost Control And Had Myself A Free-For-All Fuck Fest

  • miharu hanasaki censoredbig titsblowjobSSNIs1 no 1 stylemichiru arashiyamaSSNI-979SSNI979ssni00979
    • 2021-02-11
    301 min

    [SVOMN-153]Meat Urinal 46 - The Road To Servitude 300 Minutes, Works Collection

  • censoredSVOMNsadistic villagesadie bestSVOMN-153SVOMN1531svomn00153
    • 2021-02-14
    66 min

    SIRO-4425 [First shot] [Gal x beautiful breasts x squirting] [Slender beautiful body] Yariman gal who looks good with white skin and blonde hair participates in the war! Real sex attracted by female college students belonging to the drinking circle i

  • amateur censoredsquirtingamateursirosiro-4425siro4425siro-4425
    • 2021-02-17
    82 min

    [TG-088](A Private Video Session) Super Sex With A Forty-Something Wife With Beautiful Skin And A Bushy Bush. 3 Ejaculations To Bring A Good Woman Down

  • censoredTG1059 tokyoTG-088TG088h-1304tg00088
    • 2021-02-27
    119 min

    [MIDE-893]Salon de Slut: Beauty Salon Welcoming Hard Dicks With Sweet Whispers And Colossal Tits - Fumika Nakayama

  • nakayama fumika censoredbig titsslutMIDEmoodyzsamoarimoodyz divaMIDE-893MIDE893mide00893
    • 2021-02-27
    120 min

    [JUFE-263]Beautiful Secretary With A Nice Plump Body And Colossal Tits Flaunts Her Sexual Desires And Addiction To Cock! Rui Miura

  • rui miura censoredcreampiebig titsJUFEfitchJUFE-263JUFE263jufe00263
    • 2021-03-16
    46 min

    FC2PPV 1729348 [Ona prohibited series! ] Creampie SEX from 3 shots without a blow job ♥ Shooting that was forbidden for a week, it should be a promise only for a blow job … Creampie www * High quality version & review benefits included [Perso

  • amateur uncensoredfc2
    • 2021-03-16
    113 min

    [MXGS-1175]A Slender And Beautiful Girl With Short Hair Suzu Monami Is Getting A Quickie And Instantly Sucking Dick

  • monami bell censoredcreampiebeautiful girlMXGSmaxingMXGS-1175MXGS1175h-068mxgs01175
    • 2021-03-19
    131 min

    [TSF-016]You're A Band Musician, But When You Wake Up In The Morning, You Discover That You've Been Transformed Into A Woman (21) A Thorough Investigation "I'm Telling You, I'm A Guy!" I Tried To Resist, But Once I Realized H

  • wataru okamura censoredcreampiebeautiful girlTSFkaguyahimept mousouzokugynecomastia reportTSF-016TSF016tsf00016
    • 2021-03-20
    120 min

    [OFKU-177]Blowjob From My Wife's Mom "We're Not Related So There's No Problem If I Suck Your Cock"

  • censoredblowjobmature womanOFKUstar paradisemom railOFKU-177OFKU177h-254ofku00177
    • 2021-03-25
    135 min

    1Pondo 032521_001 Ryu Enami : Ryu Enami Special Edition

  • amateur uncensored1pondo
    • 2021-04-10
    147 min

    [SINN-019]Distressing Super Masochistic Cuckholding! The Story Of How I Rented Out My Beloved Wife On A Whim And She Was Impregnated By Being Cum In Over And Over!

  • censoredcreampieSINNshinsekai mousouzokucurious adultererSINN-019SINN019sinn00019
    • 2021-04-13
    58 min

    299EWDX-357 A transparent black strike and huge breasts invite a man. Libido contrary to the innocent face!

  • amateur censoredcreampiebig titsewdxewdx-357ewdx357299ewdx-357
    • 2021-04-22
    123 min

    [FSDSS-208]Unlimited Number Of Ejaculations! Girl Who Loves Older Men Will Let You Cum As Many Times As You Want Sora Shiina

  • shiina sky censoredcreampiesingle workFSDSSfalenowild sevenfaleno starFSDSS-208FSDSS2081fsdss00208
    • 2021-04-22
    240 min

    [NHDTB-523]She Was Trying To Hold In Her Pee When He Shoved His Big Cock Into Her And Furiously Began To Pound Her Pussy With Piston-Pumping Power! Unable To Withstand The Pleasure, This Sch**lgirl Pissed Herself In Ecstasy And Was Twitching And Trem

  • censoredsquirtingNHDTBnatural highNHDTB-523NHDTB5231nhdtb00523
    • 2021-05-20
    120 min

    [NXG-362]Traveling Saleswoman Sells Men's Underwear And Sex Toys Carefully Selected Beautiful Women Special Collection

  • censoredbig titsblowjobNXGstar paradisenext groupNXG-362NXG362h-254nxg00362
    • 2021-06-01
    120 min

    [NACR-428]Daydreaming About My Son's Wife... Miyabi Midorikawa

  • midorikawa miyabi censoredcreampiebig titsNACRplanet plusbito sakurananakuruNACR-428NACR428h-237nacr00428
    • 2021-06-11
    48 min

    FC2PPV 1863160 Limited time offer [Individual shooting] Prefectural general course ① Freshmen. She is a curious girl who dedicates her first experience to her uncle.

  • amateur uncensoredfc2
    • 2021-06-11
    156 min

    [JUFE-294]My Very Own Convenient Sucking Pet: Compliant, Soft Maid College Girl With Colossal Tits Edition - Reina Toen

  • reina taoyuan censoredcreampiebig titsJUFEfitchJUFE-294JUFE294jufe00294
    • 2021-06-12
    241 min

    [NASH-522]A Married Woman Who Turns Her Husband Into A Cuckold While He Doesn't Notice

  • ayako inoue kumi kanzaki censoredmature womandramaNASHnadeshikoNASH-522NASH522nash00522
    • 2021-06-16
    239 min

    [HUNTB-033]"What If I Touched It To Get You Used To It？" I Pop Wood At Anything These Days And It's So Embarrassing... My (Private Tutor, Stepsister, C***dhood Friend) Offered To Help Me Train My Erection...

  • censoredcreampieblowjobHUNTBhuntermorikihhh groupHUNTB-033HUNTB033huntb00033
    • 2021-06-25
    116 min

    483SGK-030 [Zutto Convulsions Climax] [Natural Dirty Talk] [Sensitive Constitution of Gakuburu Fawn Iki] [Raw Saddle Endless 3P] [HYPER Awakening Tsundere Gap] [Pink Hair Winner] Convulsions cum GAL is coming! Like a fawn gakuburu! Sprinkle natural D

  • amateur censoredsquirtingamateursgksgk-030sgk030483sgk-030
    • 2021-07-02
    173 min

    [NKKD-215]Shameful Community Center Seduction My Wife Was Getting Fucked By The Men On The Neighborhood Association Every Thursday At The Community Center Reiko Kobayakawa

  • kobayakawa reiko censoredcreampiebig titsNKKDjet eizoNKKD-215NKKD215nkkd00215
    • 2021-07-18
    58 min

    200GANA-2509 Seriously Nampa, First Shot. 1664 No Boyfriend At All! Picking Up A Beautiful Woman Of Strange Age Who Has A Body That Has Begun To Ripen! Man Juice And Tide Overflow From Oma ● Ko To Sex After A Long Absence! Where’S The Cool Outfi

  • amateur censoredsquirtingamateurganagana-2509gana2509200gana-2509
    • 2021-08-04
    60 min

    SIRO-4599 [First Shot] [Slut Service] [Indecent Ass Stakeout Piston] A Married Woman Wearing A Bewitching Atmosphere Appears With Her Husband’S Official Approval. A Beautiful Secretary Who Likes To Blame With A Switch On Soggy Caress Straddles A

  • amateur censoredmarried womanamateursirosiro-4599siro4599siro-4599
    • 2021-08-10
    240 min

    [KTRA-321]Blowjob From A Beautiful Girl Who Looks At You Kate Live POV Blowjob: The BEST 4 Hours With Sixteen Girls

  • yui nagase toua kotone censoredblowjobbeautiful girlKTRAk tribeKTRA-321KTRA321h-094ktra00321
    • 2021-08-14
    55 min

    FC2PPV 2021640 * Weekend Limited 2980⇒1980 ★ First Shot ☆ Small Breasts Loli Body ♥ De M Metamorphosis Ikumi 26 Years Old ☆ Nipple Bitten And Lust ♥ Pussy Blame Screaming Intense Iki ♥ Massive Vaginal Cum Shot With Raw Insertion ♥ * There Is A Privil

  • amateur uncensoredfc2
    • 2021-08-22
    98 min

    300NTK-626 [Indecent G Breast Nippon Representative Class Boyne Beauty JD & Slender International Student And Throat 4p Special! !! ] Powerful Big Pie That Jumps Out Of Cosplay! !! Reason Collapses On A Sizzle-Filled Nipple! !! Big Explosion! !! W

  • amateur censoredcreampiebig titsntkntk-626ntk626300ntk-626
    • 2021-08-24
    63 min

    511SDK-013 Life Saver Who Loves Sex & The Sea And Raw Gonzo Personal Shooting

  • amateur censoredbig titsamateursdksdk-013sdk013511sdk-013
    • 2021-08-28
    47 min

    H0930 ori1610 Sae Kubodera 35years old

  • amateur uncensoredh0930
    • 2021-09-09
    233 min

    [NHDTB-573]I Give My Step-Mom Who Has Endless Sexual Desire A Sex Lesson With Creampies Over And Over While My Step-Dad Goes Out For A Smoke

  • censoredcreampieslutNHDTBnatural highsakurai baniraNHDTB-573NHDTB5731nhdtb00573
    • 2021-09-11
    150 min

    [DVAJ-534]My Big Stepsister Likes To Go To The Tanning Salon And She Made Me Rub Tanning Oil On Her, And I Started Feeling Horny And Got An Erection, So She Took Care Of Me With A Massage That Was Pretty Borderline But Not Quite Sensual Ranka

  • ranka censoredcreampiebig titsDVAJalice japanbiba gonzoDVAJ-534DVAJ534dvaj00534
    • 2021-09-11
    125 min

    [NSFS-023]Your Most Hated Individual... Loving Wife Gets Licked Down By Terrible Boss. Kanna Hirai

  • shiori hirai censoredmature womansingle workNSFSnagae styletomitake taroNSFS-023NSFS023nsfs00023
    • 2021-09-24
    141 min

    [JUL-713][VR] Rave Review ATTACKERS Titles - Special Selection Of 16 Titles, 640 Minutes. Long Scenes Only In This Best Of Collection.

  • ai kano kazama yumi censoredbig titslesbianJULmadonnamishima rokusaburoJUL-713JUL713jul00713
    • 2021-09-29
    72 min

    FC2PPV 2262981 [Limited To 3 Days] * Immediate Dl Required Video * Gonzo Of The Gym Instructor Who Is About To Get Married Is Urgently Released. I Will Show You A Serious Wet Place Of Girls With Strong Sexual Desire In A Healthy Body. ≪No.97≫

  • amateur uncensoredfc2
    • 2021-10-05
    50 min

    1Pondo 100521_001 Hospitality: Ladies Who Are Good At Handling Cock Moe Nashigi Sara Haneda Asuka Shiina Sakura Kojima

  • amateur uncensored1pondo
    • 2021-10-08
    160 min

    [BANK-055]Creampied In The Outside Hot Spring: This Studious But Horny I-Cup College Girl Loves Being Commanded

  • censoredcreampiebig titsBANKma ko ginkoutakechanBANK-055BANK055h-1495bank00055
    • 2021-10-16
    89 min

    [DANDAN-009]I Met This Girl In An Online Game, And I Thought She Would Be A Plain Jane, But She Turned Out To Be A Bitchy Gal!! She Invited Me To A Private Room Izakaya Bar, And As We Were Fucking, She Continued To Tease Me, And When I Could No Longe

  • censoredcreampieblowjobDANDANdandykikujiro ozuDANDAN-009DANDAN0091dandan00009
    • 2021-10-27
    48 min

    [ETQR-300][Daydream POV] Arisa, A Receptionist Who Wants To Be Fucked

  • censoredcreampieuniformETQRerotic timeETQR-300ETQR300etqr00300
    • 2021-11-12
    177 min

    [BLK-537]No Need For Condoms Or Sunscreen! AV Debut of Beach Happiness Slut That Takes The D*cks of The Beach House Part-Timers Hamabe Anna

  • anna beach censoredcreampieblowjobBLKkira kirazampakira hosi kira black galBLK-537BLK537blk00537
    • 2021-11-13
    136 min

    [GVH-317]Double Anal Bitches 9 June Lovejoy Ayaka Mochizuki

  • june lovejoy ayaka mochizuki censoredanalGVHglory questtorindoru tanakaGVH-317GVH317gvh00317
    • 2021-11-14
    115 min

    [083PPP-2286]母乳デリヘルで働きだした兄貴の嫁さんとヤリたい～やたらエロい乳首をチュウチュウしゃぶり尽くす

  • amateur censoredbig titsmarried womanpppppp-2286ppp2286083ppp-2286
    • 2021-11-16
    64 min

    285ENDX-366 Baby Face H Cup Sweetheart JD Creampie 2 Shots! One Chest Shot!

  • amateur censoredcreampiebig titsendxendx-366endx366285endx-366
    • 2021-12-03
    146 min

    [CAWD-316]Erotic But Wise College Girl Gets Sexual Awakening And Has Wild Climactic Sex. Reina Mori

  • rena mori censoredbig titssquirtingCAWDkawaiirakudaCAWD-316CAWD316cawd00316
    • 2021-12-05
    62 min

    FC2PPV 2487791 Until 12 2480 [No] A Beautiful Hostess. She Commits A Fair And Slender Body With Multiple People And Vaginal Cum Shot Without Permission.

  • amateur uncensoredfc2
    • 2021-12-10
    146 min

    [SSIS-257]Is She Luring Me To Temptation With Her Titties, Right Here!？ If We Get Caught, It"s Over, But Even Though We Can"t Make A Sound, My Girlfriend"s Older Sister Slut Keeps On Tempting Me With Her Big Tits And Rubbing Me With Immor

  • saki okuda censoredbig titsblowjobSSISs1 no 1 stylerokusaburo mishimaSSIS-257SSIS257ssis00257
    • 2021-12-10
    107 min

    [VENX-098]"Do My Panties Turn You On？" Aunt Who Squeezed Last Drop of Nephew-In-Law"s Sperm WIth Half Removed Panties. Akari Neo

  • akari neo censoredcreampiemature womanVENXvenusmajime kitanofakecest winntersVENX-098VENX098venx00098
    • 2021-12-23
    192 min

    [NHDTB-614]Breast Milk M****ter

  • censoredbig titsmarried womanNHDTBnatural highraftin maeshiroNHDTB-614NHDTB6141nhdtb00614
    • 2022-01-01
    56 min

    491TKWA-207 Her 4 Kudo Lara Out In This Daughter

  • amateur censoredcreampieamateurtkwatkwa-207tkwa207491tkwa-207
    • 2022-01-12
    60 min

    10musume 011222_01 Chunky Cabin attendant: I want to get on your jumbo quickly Noriko Sasaki

  • amateur uncensored10musume
    • 2022-02-14
    61 min

    FC2PPV 2662629 [First Shot] Continuous Vaginal Cum Shot To An Active Professional Golfer Macho Married Woman ☆ "I Became A Professional Before I Was 30 Years Old, And Then I Made A Child" ☆ "I Am Good At Cowgirl Position" [Personal Sh

  • amateur uncensoredfc2
    • 2022-02-23
    123 min

    [FSDSS-363]Obsessive Female Teacher Chases Me Relentlessly Till We Do Nothing But Get Lost In Crazed Forbidden Sex. Yuko Ono

  • yuko ono censoredblowjobFSDSSfalenoyamaguchi memberfaleno starFSDSS-363FSDSS3631fsdss00363



    • Jav Cherry, watch JAV streaming online japanese xxx