• Log in

  • Sign up
JavCherry
  • Home
  • Jav Uncensored
  • Jav Censored
  • New Releases
  • Trending
  • actors
  • Tags
  • Random Videos
  • Upload your videos
    • Log in
    • Sign up
  • Home
  • Jav Uncensored
  • Jav Censored
  • New Releases
  • Trending
  • Random
  • amateur

  • anal

  • bdsm

  • big tits

  • blowjob

  • bukkake

  • cosplay

  • creampie

  • cumshot

  • deepthroat

  • handjob

  • hardcore

  • japan

  • lesbian

  • lingerie

  • maid

  • married woman

  • massage

  • milf

  • nurse

  • office

  • outdoor

  • school

  • schoolgirl

  • single work

  • squirt

  • teacher

  • teen

  • uniform

erika yamamoto




FC2NACRBLKDASDMVSDMEYDMARASANGVHSHKDPREDKBIHODVADNHMNDASDWANZAPODMILKLULUAWD

2019-06-29
239 min

[MIZD-143]Pantyhose/Total Domain/A Tight Skirt/A See-Through Bra/Panty Shot Action... Get Ready To Ejaculate To Hot Female Employees!! Super Selections Of The Best Office Ladies 4 Hours

  • momose yuri mizuno chaoyang censoredMIZDmoody smoodyz bestMIZD-143MIZD143mizd00143
  • 2018-12-19
    130 min

    [OVG-093]"Oh! You're Inside Me Raw!" When Her Pussy And His Dick Were Rubbing Up Against Each Other In An Oiled Up Pussy Grind Session, It Felt So Good That His Dick Just Slipped Right In, Raw!! Delivery Health Call Girls Who Got Creampie

  • sena ai akari maijima censoredcreampiebig titsOVGglory questOVG-093OVG09313ovg00093
  • 2018-03-11
    444 min

    [NSPS-684]We're Gang Bang Fucking, Gang Bang Fucking Some More, And Getting Gang Bang Fucked! 5 Girls Who Got Gang Bang Fucked

  • rina uchimura yamamoto miwako censoreddramaNSPSnagae stylenagaeNSPS-684NSPS684nsps00684
  • 1



  • Jav Cherry, watch JAV streaming online japanese xxx
    • Legal

    • 18 U.S.C. 2257
    • Contact Us
    • DMCA
    • Useful

    • Sign up
    • Log in
    • FAQ
    • Contact
    • Friends

    • Girls Do Porn
    • GirlsDoPorn
    • DaftSex
    • TayLee Wood
    • WoodmanCastingX
    •